KEGG   Streptomyces lincolnensis: SLINC_5968Help
Entry
SLINC_5968        CDS       T04801                                 

Definition
(GenBank) glycosyl hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
sls  Streptomyces lincolnensis
Pathway
sls00460  Cyanoamino acid metabolism
sls00500  Starch and sucrose metabolism
sls01100  Metabolic pathways
sls01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sls00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SLINC_5968
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SLINC_5968
Enzymes [BR:sls01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SLINC_5968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 CBM_11 Glyco_hydro_3_C Calx-beta CIA30
Motif
Other DBs
NCBI-ProteinID: ANS68192
UniProt: A0A1B1MIH3
Position
7107892..7110912
Genome map
AA seq 1006 aa AA seqDB search
MRRTALLASATLLAALIPLTTAQAAPDDPAPTPVDRFEGEVPFASPPAEGIFTWGGDTDD
PPRLELTPRTDAPEGSHVLSGTYDISGYGGFTHDFAFAEPARDWSARKGIRFWWEGQNNG
KKVAFELKDGGANGEASELWTTSFTDDFSGWKQIELPFGDFAYRTDYQPVGGIDHVLGLT
GMWGYAVTLPTGAEGRFAMDGVEVYGRADQSLRANVLTDAAVYPVREGGTAAVEVTVATT
GSAPLDEPVTVAYETAATGTAESGKDYTPVSGTLTFPAGTASGASRSVRVPTLKDKGAEA
AETIPLKLTVTGAKPPAEPPQVVVDAHGLPYLDPRLPVKKRVADLLGRMSPAEKAGQMTQ
AERAAVGAAPGDIAAYDLGSLLSGGGSTPTPNTPEAWARMIDGFQLRAQATRFQIPLIYG
VDAVHGHNNLVGATIMPHNIGLGAARDPRLARRTASVTAAEVRATGIPWDFAPCLCVTRD
DRWGRAYEAFGEDPALVDAMASVVQGFQGARDGRDLKDDDKVLATAKHFVGDGGTEFGSS
STDGYTIDQGVTKVTRQELEAVHLAPYETAVERGVGTVMPSFSSLDIVGDGRGPVKMHAR
TDMLTGVLKGRMDFDGFVISDWAAIDQLPGDYASDVRTSVNAGLDMIMVPNAYRDFHSTL
VAEVGAGRIDERRVDDAVSRILTQKFRLGLFEKPYADTDGADRIGSAAHRAVAREAAAKS
QVLLKNAGGVLPLGKNQKVYVAGSNADDIGNQSGGWTVTWQGASGDITPGTTVLEAMRKN
SGRLTYSQDASAPTAGHDVGVVVVGETPYAEGLGDVGNGHDLELSAADQAAVDTVCAAMK
CAVLIVSGRPQLLGDRLGDIDALVASWLPGTEGDGVADVLYGKRPFTGRLPVTWPRSEAQ
LPINVGDTAYDPQYPYGWGLTTLAKAPEGGAGTLGALAVAARAAERTGAEEAGRAIVGKA
RLIVQRKAGDTLTPAVAKPFADAEHLLLTGRYGKAVDRLAAAYRAA
NT seq 3021 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagaaccgccctgttagcctccgccaccctgctcgccgcactgatcccgctgacc
accgcgcaggcggcccccgacgaccccgcccccacccccgtcgaccgcttcgagggggag
gtccccttcgcgtcgccgcccgccgagggcatctttacctggggcggtgacaccgacgac
ccgccgcgactggaactcaccccgcggaccgacgcccccgagggctcccacgtgctctcc
ggcacctacgacatcagcggctacggcggtttcacacacgacttcgccttcgccgagccc
gcccgcgactggtccgcccgcaaggggatccgcttctggtgggaagggcagaacaacggc
aagaaggtggccttcgagctgaaggacggcggcgccaacggcgaggcgtccgagctgtgg
acgacgtcgttcaccgacgacttcagcggctggaagcagatcgagctccccttcggcgac
ttcgcgtaccgcacggactaccagcccgtcggcggcatcgaccacgtcctcggactcacc
gggatgtgggggtacgccgtcaccctccccacgggtgccgagggccggttcgccatggac
ggcgtggaggtgtacggcagagccgaccagtccctgcgggcgaacgtcctgaccgacgcc
gccgtgtacccggtgcgggagggcggcacggccgccgtcgaggtcaccgtcgccaccacc
ggttccgctcccctcgacgagccggtgaccgtcgcctacgagacggccgcgaccggcacc
gcggaatccggcaaggactacacgccggtctccggcaccctcaccttccccgcgggcacg
gcctccggcgcctcgcggtccgtccgggtcccgaccctgaaggacaagggcgccgaggcc
gccgagacgatcccgctgaagctcaccgtcaccggcgccaagcccccggccgagcccccg
caggtcgtcgtggacgcgcacgggctgccgtatctcgacccgcggctgccggtgaagaag
cgcgtcgccgatctcctgggccggatgtccccggccgagaaggccggccagatgacgcag
gccgagcgcgccgccgtcggcgccgctcccggcgacatcgccgcgtacgacctcggctcg
ctgctgtccggcggcggctccacacccacgcccaacacccccgaggcctgggcgcggatg
atcgacggcttccaactccgggcacaggccacgcggttccagatcccactgatctacggc
gtcgacgcggtgcacggccacaacaacctggtcggcgcgacgatcatgccgcacaacatc
ggactcggagccgcccgcgatccccgactggcccggcggaccgcctcggtgaccgcagcc
gaggtccgcgcgaccggcatcccgtgggacttcgccccgtgcctgtgcgtcacccgcgac
gaccgctggggccgcgcctacgaggccttcggtgaggacccggccctcgtcgacgccatg
gcgagtgtcgtccagggcttccagggcgcccgcgacgggcgggacctgaaggacgacgac
aaggtcctcgccaccgccaagcacttcgtcggcgacggcggcaccgagttcggctcctcc
agcaccgacgggtacaccatcgaccagggcgtcaccaaggtcacccggcaggagctggag
gccgtccacctggcaccgtacgagacggccgtcgagcgcggtgtcgggaccgtcatgccc
tcgttctcctcgctggacatcgtcggcgacggacggggcccggtgaagatgcacgcccgc
accgacatgctcaccggtgtgctgaagggccgtatggacttcgacggcttcgtgatcagc
gactgggcggccatcgaccaactgcccggcgactacgcctccgacgtccgtacgtcggtc
aacgccggactcgacatgatcatggttccgaacgcctaccgggacttccacagcaccctc
gtcgccgaggtcggggcgggccggatcgacgagcggcgcgtcgacgacgccgtctcccgc
atcctcacgcagaagttccggctcggcctcttcgagaagccgtacgccgacaccgacggc
gcggaccggatcggttccgccgcccaccgggccgtggcccgcgaggcggccgcgaagtcg
caggtgctgctgaagaacgcgggcggtgtcctgccgctggggaagaaccagaaggtgtac
gtcgccgggtccaacgccgacgacatcggcaaccagtccggcggctggaccgtcacctgg
cagggcgcctccggtgacatcacccccggtacgaccgtcctggaggccatgcgcaagaac
tccgggcggctgacgtactcccaggacgcctcggccccgaccgccggccatgacgtcggc
gtggtcgtcgtgggggagaccccgtacgccgagggcctcggtgacgtcggcaacggccac
gacctggagctctccgccgccgaccaggcagcggtcgacacggtgtgcgcggccatgaag
tgcgcggtgctgatcgtctccgggcgtccccagctcctcggcgaccggctcggtgacatc
gacgcgctggtcgcctcctggctcccgggcacggagggcgacggcgtggccgacgtcctg
tacggcaagcggcccttcaccggccggctcccggtgacctggccgaggtccgaggcccag
ctgccgatcaacgtcggcgacacggcctacgacccgcagtacccgtacggctggggcctg
acgaccctcgccaaggccccggagggcggcgcgggaaccctgggggcactcgccgtcgcg
gccagggcggccgagcggaccggggccgaggaggcgggccgggcgatcgtcggcaaggcc
cggctgatcgtccagcggaaggccggcgacaccctcacgcccgcggtcgcgaaacccttc
gccgacgcggagcacctgctcctgaccggacggtacggaaaggcggtggacaggctggcg
gcggcctaccgggcggcctga

DBGET integrated database retrieval system