KEGG   Sideroxydans lithotrophicus: Slit_0423Help
Entry
Slit_0423         CDS       T01196                                 

Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00860  Porphyrin and chlorophyll metabolism
slt01100  Metabolic pathways
slt01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Slit_0423
Enzymes [BR:slt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     Slit_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: ADE10664
UniProt: D5CM50
Position
426362..427765
Genome map
AA seq 467 aa AA seqDB search
MSVNKEISPQLEVDLDLIRRLDKNGPRYTSYPTADRFVEAFNAETYAQWVGKREVGGISR
PLSLYVHIPFCNTLCFYCACNKVVTKDFSKADQYIRYLIKEIGMQAALLGKERRVEQLHF
GGGTPTFLSDDELRQVMGAIRKNFQLVEDGEYSIEIDPRKVSDATVALLGELGFNRISIG
VQDFDPEVQKAVNRIQSEAETLQVIKAARANGFKSVSIDLIYGLPKQTMAGFKATLDKVI
AANPDRLSIYNYAHMPTLFKPQRRIHDEDLPAPQTKLDILKLAVNTLTDAGYVYIGMDHF
AKPDDELAVAQRQGRLHRNFQGYSTHSDCDLIAVGVSSIGKVGPTYSQNFRELEQYYDAL
DNDILPIMRGMELNADDLVRRAIIQALMCHFEISKESFNISYLIDFDHYFATELKELAEY
EKEGLLKLSPQWISVTPKGRMLIRNICMVFDKYLRTKQEHARYSKVI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcaacaaagaaattagcccccagctggaagtcgatctggacttgattcgccgc
ctggacaagaacggtccgcgctatacctcctaccccactgccgaccgctttgtcgaggcg
ttcaatgccgagacctatgcgcaatgggtaggcaagcgcgaagtcggcggcatcagccgg
ccactgtccttgtatgtccacatcccgttctgcaacacgctgtgtttctactgcgcctgc
aacaaggtggtaaccaaggatttcagcaaggccgaccaatatattcgctatctcatcaag
gagatagggatgcaggccgcgctattgggcaaagagcgccgtgtcgagcaactgcacttc
ggtggcggcacgccgactttcctgagcgacgatgagctgcgccaggtgatgggagcgatc
cgcaagaacttccagctggtggaagacggcgagtactccatcgagatcgatccgcgcaaa
gtgagcgatgccacggtggcgctgttgggtgaactggggttcaaccgtatcagtatcggg
gtgcaggatttcgatcccgaagtgcaaaaggcggtgaaccgcatccagagcgaagcggag
accttgcaggtcatcaaggctgcgcgtgccaacggcttcaaatcggtgagcatcgatctc
atctacggcctgcccaagcagaccatggccggtttcaaggcgaccttggacaaggtcatc
gcggccaaccctgaccgcctgtccatctataactacgcgcacatgccgaccttgttcaag
ccgcagcgacgcatccacgacgaagacctgccggcgccgcaaaccaagctcgacatcctg
aaactggcggtgaacaccctgaccgacgccggttatgtatatatcggcatggaccatttc
gccaagccagacgacgaactggcggtggcgcagcgccagggccgcctgcaccgcaatttc
caggggtattcgactcactcggactgcgacctgatcgcggtgggggtgagctccatcggc
aaggtcgggccgacttacagccagaacttccgcgaactggaacaatactacgacgcgctg
gacaacgatattctgccgatcatgcggggcatggaactgaatgccgacgacttggttcgc
cgtgcgatcatccaggccctgatgtgtcacttcgagatatcgaaggagtcgttcaatatc
tcctacctgatcgatttcgaccattacttcgccaccgaattgaaggaactcgcagaatac
gaaaaagaagggctgctgaagctctcgccgcaatggatcagcgtgacgcccaaaggccgc
atgttgatccgcaacatctgcatggtattcgacaaatacctgcgcacgaagcaggaacac
gcgcgttattccaaagtcatctag

DBGET integrated database retrieval system