KEGG   Sideroxydans lithotrophicus: Slit_0446Help
Entry
Slit_0446         CDS       T01196                                 

Definition
(GenBank) malate/quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
slt  Sideroxydans lithotrophicus
Pathway
slt00020  Citrate cycle (TCA cycle)
slt00620  Pyruvate metabolism
slt01100  Metabolic pathways
slt01110  Biosynthesis of secondary metabolites
slt01120  Microbial metabolism in diverse environments
slt01130  Biosynthesis of antibiotics
slt01200  Carbon metabolism
Module
slt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:slt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Slit_0446
   00620 Pyruvate metabolism
    Slit_0446
Enzymes [BR:slt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     Slit_0446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ADE10687
UniProt: D5CM73
Position
454070..455551
Genome map
AA seq 493 aa AA seqDB search
MTQKKVDVLLVGAGVMSATLASLLSHLDPSLKIMMVERLSKVAHESTHSLNNAGTGHGGY
CELNYTPQLADGSIRIDRALEINAAFEVSLQFWSYLVKQGILPEPEKFINPICHQSFVWG
EEDVAFLRKRHAALHKHHLFEEMEFSEDHAVLRKWMPLVMKHRDASQAVAATRVKHGTDV
DFGLLTRKLVKSLTKHSTFDLMLSHTIVSMKQHDDGRWHVRVQDNHAGETRTIDAGFVFL
GAGGGALPLLQKSGIPEARGYGGFPVSGQWLICKNPEVVKRHCSKVYGKAAVGAPPMSVP
HLDARIIDGEPALLFGPFASITTKFLKEGSVLDLFSSLKTDNLKPMLAVARDNLDLTRYL
ITEAFRSHKERMAILRGFYIDAKEEDWELASAGQRVQIIKSCDKKGGKLEFGTEIVTAND
GTLAALLGASPGASTSVQAMIEVIERCFKPRMKSADWKHKMKEMIPSYGESLDENVALLH
EVRRHTLSTLRLG
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagaaaaaagtggatgtgttgttggtcggggctggggtgatgagcgcgacgctg
gcgtcgttgttgtcgcacctggacccgtcgctgaagatcatgatggtcgagcggctgagc
aaggtggcgcatgaaagcacgcacagcctgaacaatgcgggtaccgggcatggcgggtat
tgcgagctgaattacacgccgcagctggccgatggcagcatcaggatcgaccgcgccctg
gagatcaatgccgcattcgaggtttcgctgcaattctggtcctacctggtcaagcagggc
atattgcccgagccggagaaattcatcaatccgatatgccaccagagtttcgtctgggga
gaggaggatgtggcgtttttgcgcaagcgccatgcggcgctgcacaagcatcacctgttc
gaagagatggaattcagcgaagaccacgcggtgctgcgcaagtggatgccgctggtgatg
aaacaccgcgatgccagtcaggccgtggctgcgacgcgggtcaagcacggtaccgacgtg
gacttcggcctgctgacgcgcaaactggtgaagtcactgaccaaacactccaccttcgac
ctgatgctgagccataccatcgtcagcatgaagcagcacgacgatggccgctggcatgtg
cgggtgcaggacaatcatgccggcgagacccgcaccatcgatgccggtttcgtcttcctg
ggcgcgggcggcggcgcgctgccgctgctgcagaagtcgggtatcccggaagcgcgcggc
tatggcggttttccggtcagcggccaatggctgatctgcaagaatccggaagtggtgaag
cgccactgcagcaaggtctatggcaaggctgccgtgggtgcgccgccgatgtcggtgccg
cacctggatgcgcgcatcatcgatggcgagccggctttgctgttcgggccgttcgccagc
atcaccaccaagttcctcaaggaaggttcggtactcgacctgttctcctcgctcaaaacc
gacaacctgaagccgatgctggcggtggcgcgcgacaacctcgaccttacccgttatctc
atcaccgaagcgttccgttcgcacaaggagcgcatggcgatattgcgcggtttctatatc
gatgcaaaagaggaagactgggagctggcatcggccgggcaacgcgtgcagatcatcaag
agttgcgacaagaaaggcggcaagctggagttcggcaccgagattgtcaccgccaacgat
ggcacgctggcggcactgctgggcgcgtcacccggcgcttccacctcggtgcaggcgatg
atcgaggtgatcgagcgttgcttcaagccgcgaatgaagagcgccgactggaagcacaag
atgaaagagatgatcccgtcctacggcgaatcgctggacgagaatgtcgcactgctgcat
gaagtgcggcggcacacgctgagtacgctcaggctggggtga

DBGET integrated database retrieval system