KEGG   Sideroxydans lithotrophicus: Slit_2312Help
Entry
Slit_2312         CDS       T01196                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
slt  Sideroxydans lithotrophicus
Brite
Enzymes [BR:slt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Slit_2312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: ADE12539
UniProt: D5CLU4
Position
complement(2342605..2343189)
Genome map
AA seq 194 aa AA seqDB search
MEHQLPPLPYPREALAPHMSAETFDYHYAKHHQAYVTNLNNLIKGTEYENLELEAIIKKA
PAGGIYNNSAQVWNHTFFWNCMKPQGGGAPAGKLAEAINKKWGNLDDFKKAFQTSAVGNF
GSGWTWLVKKADGSLDIVNMGAAGTPLTTGDKALLCVDVWEHAYYIDYRNMRPKFVETFL
NNLVNWDFVAKNFA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaacaccaactgccccctctgccatatccacgcgaagcgctcgcgccgcacatgtcc
gccgagactttcgattaccactatgccaaacaccatcaggcctacgttaccaacctgaac
aacctgatcaagggtaccgaatacgagaacctggaactggaagctatcatcaagaaggcc
ccggcaggcggcatctacaacaactccgcccaagtgtggaaccacactttcttctggaac
tgcatgaagccgcagggcggcggtgcacctgcaggcaaactggccgaagccatcaacaag
aagtggggcaacctggacgacttcaagaaagccttccagacttccgccgtgggcaacttc
ggttccggctggacctggctggtgaagaaggccgacggttcgctggatatcgtcaacatg
ggtgccgccggtacgccgctgaccaccggcgacaaggcgctgctgtgcgtggatgtatgg
gagcatgcctattacatcgactaccgcaatatgcgtcccaaattcgtcgagaccttcctc
aacaatctggtgaactgggatttcgtggcgaagaacttcgcctga

DBGET integrated database retrieval system