KEGG   Streptomyces lividans: SLIV_06245Help
Entry
SLIV_06245        CDS       T03222                                 

Definition
(GenBank) tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
slv  Streptomyces lividans
Pathway
slv00450  Selenocompound metabolism
slv00970  Aminoacyl-tRNA biosynthesis
slv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SLIV_06245
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SLIV_06245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slv01007]
    SLIV_06245
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slv03016]
    SLIV_06245
Enzymes [BR:slv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SLIV_06245
Amino acid related enzymes [BR:slv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SLIV_06245
Transfer RNA biogenesis [BR:slv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SLIV_06245
 Prokaryotic type
   Other AARSs
    SLIV_06245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-ProteinID: AIJ12264
UniProt: A0A076M3G1
Position
complement(1396091..1397611)
Genome map
AA seq 506 aa AA seqDB search
MTPAPRRFLVTATPPTTNGDLHVGHLSGPYLGADVFSRAQRMLGHTVLYASGGDDHQTYV
VTTAERLGLDPVELAARCNREIVGTLELAGIDIDAFTSPDDAYRAEVREFFTGLHRAGRL
KTRTWTFPYCGRTGRYLLEAFATGYCPECLVGTCGAICENCGHPNDVDSLLFPASTGAGP
AATTQPRETEILVLPLEEYREQFTEFYRVRRATMRPHVLRFVDEMLSRPLPDFPVSYPAD
WGIPVGIDGFDGQVFNVWAEMLPGLRHMAEAARARRAPATPPGVWAADSGFELVQFLGYD
NTFYFAFAHLGLTFAHGGLTEPAAIVTNEFYHLDGAKFSTSRRHLVWARDLVGKYGADNV
RFHLALDNPEHQPANFTEADFLDTVRTRLHQPLQSIAAALAPHTGRPVTAGPRTEVLLDR
YRDRMRRAYTLETFSMRQAAETTANLLALLAARAPDDPGLAAAGLRAAAEHAAPLVPGLA
AAVEARYTAAAPGTVPDLAGLLPVTL
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggccccgcgccgcttcctggtcaccgccacaccccccaccaccaacggcgac
ctgcacgtcggccacctctccgggccctacctgggcgccgacgtcttcagccgcgcccag
cggatgctggggcacaccgtcctgtacgcgtccggcggcgacgaccaccagacgtacgtg
gtcaccacggccgagcggctgggcctggacccggtggagctggcggcccgctgcaaccgc
gagatcgtcggcacactggaactcgccggcatcgacatcgacgcgttcaccagccccgac
gacgcctaccgcgccgaggtgcgggagttcttcaccggcctgcaccgggcgggccggctc
aagacccgcacctggaccttcccgtactgcgggcggaccggccgctacctcctggaggcc
ttcgccaccgggtactgccccgagtgcctggtcggcacctgcggggcgatctgcgagaac
tgcggccaccccaacgacgtcgactccctgctcttccccgcgagcaccggcgccgggccc
gccgccaccacccagccgcgcgagacggagatcctggtcctgccgctggaggagtaccgg
gagcagttcaccgagttctaccgcgtccggcgggccacgatgcgcccgcacgtgctgcgc
ttcgtcgacgagatgctctcccggccgctgcccgacttcccggtcagctacccggccgac
tggggcatcccggtcggcatcgacggcttcgacggccaggtcttcaacgtctgggccgag
atgctgccgggcctcaggcacatggcggaggccgcgcgggcccgccgcgcccccgcgacc
ccgcccggtgtgtgggccgcggactcgggcttcgaactcgtgcagttcctcggctacgac
aacacgttctacttcgccttcgcccacctcgggctcaccttcgcgcacggcggactgacc
gagccggccgcgatcgtgaccaacgagttctaccacctggacggggccaagttctccacc
agccgccgccacctcgtgtgggcccgcgacctggtgggcaagtacggcgcggacaacgtg
cgtttccacctcgcgctcgacaacccggaacaccagcccgccaacttcaccgaggcggac
ttcctggacaccgtacgcacccggctgcaccagccgctccagagcatcgcggcggccctg
gccccgcacaccgggcggcccgtgacggccgggccgcggaccgaggtgctcctggaccgc
taccgcgaccggatgcggcgggcctacacgctggagaccttctcgatgcggcaggccgcc
gagaccaccgcgaacctgctggcgctgctcgccgccagggcgccggacgatcccgggctc
gccgccgccggtctgcgggccgccgccgagcacgccgcgcccctggtgcccggcctcgcc
gccgccgtcgaggcccggtacacggccgcggcgccgggcaccgtgccggacctggccggc
ctcctgcccgtcaccctctga

DBGET integrated database retrieval system