KEGG   Streptomyces lividans: SLIV_12985
Entry
SLIV_12985        CDS       T03222                                 

Definition
(GenBank) hydrolase
  KO
K14630  two-component flavin-dependent monooxygenase [EC:1.14.14.-]
Organism
slv  Streptomyces lividans
Pathway
slv01057  Biosynthesis of type II polyketide products
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Module
slv_M00779  Dihydrokalafungin biosynthesis, octaketide => dihydrokalafungin
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    SLIV_12985
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:slv01008]
    SLIV_12985
Enzymes [BR:slv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-  
     SLIV_12985
Polyketide biosynthesis proteins [BR:slv01008]
 Polyketide tailoring proteins
  Oxygenase
   SLIV_12985
SSDB
Motif
Pfam: Acyl-CoA_dh_2 Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M
Other DBs
NCBI-ProteinID: AIJ13586
UniProt: A0A076M013
Position
complement(2973265..2974410)
AA seq 381 aa
MSEDTMTQERPSLTAHARRIAELAGKRAADAEQQRRLSPDVVDAVLRAGFAAHFVPVAHG
GRAATFGELVEPVAVLGEACASTAWYASLTASLGRMAAYLPDEGRAELWSDGPDALIVGA
LMPLGRAEKTPGGWHVSGTWPFVSVVDHSDWALICAKVGEEPWFFAVPRQEYGIVDSWYP
MGMRGTGSNTLVLDGVFVPDARACTRAAIAAGLGPDAEAICHTVPMRAVNGLAFALPMLG
AARGAAAVWTSWTAGKLAGPTGQNAVSSQDRVVYEHTLARATGEIDAAQLLLERVAAVAD
AGSATGVLVGRGARDCALAAELLTAATDRLFASAGTRAQAQDSPMQRLWRDVHAAGSHIG
LQFGPGAALYAGELLRRSNDG
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgagcgaggacacgatgacccaggagcggccgtccctgacggcacacgcccgccggatc
gccgaactcgccgggaagcgggcggccgacgccgaacagcagcgtcggctgagccccgac
gtcgtcgacgcggtccttcgggccggtttcgccgcccacttcgtaccggtggcgcacggc
ggccgggccgcgacgttcggggagctggtggagcccgtcgcggtgctcggcgaggcctgt
gcctcgaccgcctggtacgcctcgctcacggcgagcctcggccggatggccgcctacctg
ccggacgagggccgggccgagctgtggtccgacggccccgacgccctgatcgtcggtgcc
ctgatgccgctgggccgggccgagaagaccccgggcggctggcacgtgtcgggcacctgg
ccgttcgtcagcgtcgtggatcactccgactgggcgctgatctgcgccaaggtcggcgag
gagccgtggttcttcgcggtgccgcgacaggagtacgggatcgtcgacagctggtacccg
atgggtatgcgcggaacgggcagcaacacgctcgtcctcgacggggtgttcgtgccggat
gcgcgggcctgcacccgtgcggccatcgcggcaggtctcggtccggatgccgaggcgatc
tgtcacaccgtgcccatgcgggcggtcaacgggctggccttcgcactgccgatgctcggc
gcggcccgcggggccgcggccgtgtggacctcgtggaccgccggaaagctggccgggccg
accgggcagaacgccgtctcgtcccaggaccgcgtggtgtacgagcacacgctggcccgg
gccacgggtgagatcgacgcggcccagctgctgttggagcgggtcgcggcggtcgccgac
gccggctcggcgaccggcgtactggtcggccgcggggcgcgggactgcgccctggcggcg
gagctgctgaccgccgcgaccgaccggctgttcgcctcggcgggcacccgggcacaggcc
caggacagcccgatgcagcgcctgtggcgcgatgtgcacgcggcgggcagccatatcggg
ctgcagttcgggcccggggcggcgctgtacgccggagagctgttgaggaggagcaacgat
ggctga

DBGET integrated database retrieval system