KEGG   Streptomyces lividans: SLIV_21555Help
Entry
SLIV_21555        CDS       T03222                                 

Definition
(GenBank) aminotransferase
  KO
K16423  (S)-3,5-dihydroxyphenylglycine transaminase [EC:2.6.1.103]
Organism
slv  Streptomyces lividans
Pathway
slv00261  Monobactam biosynthesis
slv01055  Biosynthesis of vancomycin group antibiotics
slv01100  Metabolic pathways
slv01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01055 Biosynthesis of vancomycin group antibiotics
    SLIV_21555
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    SLIV_21555
Enzymes [BR:slv01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.103  (S)-3,5-dihydroxyphenylglycine transaminase
     SLIV_21555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Motif
Other DBs
NCBI-ProteinID: AIJ15247
UniProt: D6ES45
Position
4801227..4802561
Genome map
AA seq 444 aa AA seqDB search
MTTTTPARTDRDGVLARTALHPSLSAPLLDTMNFLNEVTLRYPQAISFAPGRPYEGDFDV
ARVPGYIETYLDHLRGRGHSEERVRTALYQYGETAGQIRDIVARMLEVDEDLTVDPASVV
VTVGCQEAVLLTLRALFTGPEDVLLVDSPAYVGITGAAGLLDIPVVPVPGTPDGPSPEGL
ERTVREIEASGRRARCLYVVPDCSNPTGVSMRREARTALLDAAARLDLLLLEDNPYGVFS
RVRRPTLKSLDTERRVVYLGSFAKTAFPGARVGFVVADQLVAGADGRPPGLLAHELAKVK
SMVTVNTPTLSQAAVAGLLLQNGGGLRAANEASARHYQSTMRCLRDTLAAELPPGAPESD
GVRWNDPDGGFFLTLDVPFEADEAALDVSAEKYGVIWTPMRHFHLDDAGDRQIRLSCSYL
TTDRAAEGATRLARFVKDRATSNG
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaccaccccagcgcgcacggaccgggacggcgtcctggcgcggaccgccctg
caccccagcctgtccgccccgctgctcgacacgatgaacttcctcaacgaggtgaccctc
cgctacccgcaggcgatctccttcgccccgggacgcccctacgagggagacttcgacgtc
gcacgcgtccccgggtacatcgagacctacctcgaccacctgcgcgggcgcggccactcc
gaggaacgcgtccgcaccgcgctctaccagtacggcgaaaccgccgggcagatcagggac
atcgtcgcccgcatgctcgaggtggacgaggacctgacggtcgaccccgcctccgtggtg
gtgacggtcggctgccaggaggccgtcctgctcaccctgcgcgccctgttcaccggtccg
gaggacgtgctcctcgtcgacagtcccgcctacgtcggcatcaccggcgcggccggcctg
ctggacatccccgtcgtgccggtgcccggcacccccgacgggccgagcccggaagggctg
gagcgcaccgtccgggagatcgaggcgagcggccggcgcgccaggtgcctgtacgtggtg
cccgactgctccaacccgaccggcgtcagcatgcgccgcgaggcccgcaccgccctgctc
gacgccgccgcgcggctggacctgctcctcctggaggacaatccctacggggtgttcagc
cgggtgcgccgccccaccctcaagtccctcgacaccgaacggcgcgtcgtctacctcggt
tccttcgcgaagacggccttcccgggcgcccgcgtcggcttcgtcgtcgccgaccagctc
gtggccggcgcggacgggcggccgcccggtctgctcgcccacgaactggccaaggtcaag
agcatggtcaccgtcaacacccccaccctgagccaggccgcggtcgccggactgctgctg
cagaacggcgggggactgcgggcggcgaacgaggcctcggcccgccactaccagtccacg
atgcggtgcctgcgcgacaccctcgccgccgaactgccgcccggcgcaccggaatcggac
ggcgtgcggtggaacgacccggacggcgggttcttcctgaccctcgacgtgcccttcgag
gcggacgaggccgcgctggacgtctccgcggagaagtacggcgtcatctggaccccgatg
cgccacttccacctggacgacgcgggcgaccggcagatccgcctctcgtgcagctacctc
accaccgaccgcgccgccgagggggcgacgcggctggcccgcttcgtcaaggaccgcgcg
acgtctaacggttga

DBGET integrated database retrieval system