KEGG   Streptomyces lividans: SLIV_28235Help
Entry
SLIV_28235        CDS       T03222                                 

Definition
(GenBank) hypothetical protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
slv  Streptomyces lividans
Pathway
slv00053  Ascorbate and aldarate metabolism
slv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    SLIV_28235
Enzymes [BR:slv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     SLIV_28235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd NAD_binding_4 Polysacc_synt_2 NAD_binding_10 RmlD_sub_bind adh_short NmrA KR
Motif
Other DBs
NCBI-ProteinID: AIJ16555
UniProt: D6ELC3
Position
complement(6311106..6311915)
Genome map
AA seq 269 aa AA seqDB search
MPAPRTVLLTGAAGGLGTLMRELLPGHGYELRLLDLLPVEGEPDAIVADLADRDALREAV
RGVDAIIHLAGISLEASFDKILAANIEGTYNLYEAAREEGVGRIVFASSNHAVGYTPRPQ
GDDPLIPIDTPRRPDTFYGLSKCFGEDLAQLYWDKHGIETVSVRIGSCFPEPTSVRMLSV
WMSPADGARLFHAALTAENVGHTVVHGSSANTRLWWDLTSARALGYEPQDDSEPYAGKLV
AEQGELDPGNPAHARLGGHFVTDPPIWPY
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcccgctccccgcaccgtcctgctcaccggcgccgccggcggcctcggcaccctgatg
cgggaactgctccccggccacggctacgagctgcgcctgctcgacctgctcccggtcgag
ggcgagccggacgcgatcgtcgccgacctcgccgaccgggacgccctgcgcgaggcggtc
cggggcgtcgacgcgatcatccacctcgcgggcatctccctggaagcctctttcgacaag
atcctcgcggcgaacatcgagggcacgtacaacctgtacgaggccgcccgcgaggagggc
gtcggccgcatcgtcttcgcctcctccaaccacgccgtcggctacaccccccggccgcag
ggcgacgaccccctcatccccatcgacacgccacgccgcccggacaccttctacggcctg
tccaagtgcttcggcgaggacctcgcccagctctactgggacaagcacggcatcgagacc
gtctccgtccgcatcggctcctgcttccccgagccgaccagcgtgcgcatgctctcggtg
tggatgagccccgcggacggcgcccgcctcttccacgcggcactcaccgccgagaacgtg
gggcacaccgtcgtccacggctcctccgccaacacccgcctgtggtgggacctgacctcc
gcacgggcgctcggttacgagccgcaggacgactccgagccgtacgccggcaagctcgtc
gccgaacagggcgaactcgaccccggcaacccggcgcacgcccgcctgggcggccacttc
gtgaccgaccccccgatctggccgtactga

DBGET integrated database retrieval system