KEGG   Streptomyces lividans: SLIV_28490Help
Entry
SLIV_28490        CDS       T03222                                 

Gene name
pit2
Definition
(GenBank) putative low-affinity inorganic phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
slv  Streptomyces lividans
Brite
KEGG Orthology (KO) [BR:slv00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    SLIV_28490 (pit2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF4131
Motif
Other DBs
NCBI-ProteinID: AIJ16606
UniProt: D6ELH6
Position
complement(6367343..6368614)
Genome map
AA seq 423 aa AA seqDB search
MESFSLILAIVVVTALAFDFTNGFHDTANAMATTISTGALKPKVAVAMSAVLNLVGAFLS
VEVANTISKGLVDETGIRPEVIFAALVGAILWNLLTWLVGLPSSSSHALMGGLIGAAVAS
AGIGAVNGDVLVTKVLLPAIAAPIVAGLAALLASRMTYSLGRRADGRAAAKGYRAGQIAS
AGLVSLAHGTNDAQKTMGIITLALIAGGSLAPDSDPPVWVILSAGLAIALGTYLGGWRII
RTMGKGLTDLQPQQGFAAQTSAATVILASSHLGFSLSTTHSVSGAVMGAGLGRKGGVVRW
STATRMFVAWGLTLPAAALVAALAEWVCRAGDWGTALVAVFLIASSFAIWRISRREVVDH
TNVVDGGPVDTEGPGQPEPAGVVTTAMAAVSPPPTGATEELAATLPAPATTPDPKAPSAA
TTV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggaaagcttctcgctgatcctcgcgattgtggtggtaaccgcactcgcgtttgatttc
acgaacggtttccacgacaccgcgaacgcgatggcgacgaccatttcgaccggtgcgctc
aagcccaaggtggcggtggcgatgtccgccgtcctcaaccttgtaggcgccttcctctcg
gtggaggtcgccaacacgatctccaagggtctcgtcgacgagaccggcatccgtcccgag
gtcatcttcgccgccctggtcggcgcgatcctctggaacctcctgacctggctggtcggg
ctcccgtccagctcctcgcacgccctgatgggcggcctgatcggtgccgccgtcgcctcg
gccggtatcggcgcggtcaacggcgacgtgctcgtcaccaaggtgctcctcccggcgatc
gccgccccgatcgtggccggcctcgcggcgctgctggcgtcccggatgacgtactcgctg
ggccgcagggccgacggcagggccgccgcgaagggttaccgggccgggcagatcgcctcc
gccggtctggtctcgctggcgcacggcaccaacgacgcccagaagaccatgggcatcatc
accctcgccctgatcgccggcggctcgctcgcccccgactccgacccgccggtgtgggtc
atcctgagcgcgggcctggccatcgcgctcggcacctacctgggcggctggcgcatcatc
cgcaccatgggcaagggcctgaccgacctccagccgcagcagggcttcgccgcccagacc
agcgccgccacggtcatcctggcctcctcccacctcggcttctcgctgtccaccacgcac
tcggtctccggtgcggtgatgggcgcgggcctcggccgcaagggcggcgtggtccgctgg
tccacggccacccggatgttcgtcgcctggggcctgacgctgccggccgcggccctggtc
gccgcgctcgccgagtgggtctgccgcgccggcgactggggcacggccctcgtcgcggtg
ttcctgatcgcctccagcttcgcgatctggcggatctcccgccgggaggtcgtcgaccac
accaacgtcgtcgacggcggtccggtggacaccgaggggccggggcagcccgagcccgcc
ggtgtggtcaccacggcgatggccgccgtgtcgccgcccccgacgggcgcgaccgaggaa
ctggcggccaccctccccgccccggccaccacccccgaccccaaggccccgtcggccgcc
accaccgtctga

DBGET integrated database retrieval system