KEGG   Streptomyces lividans: SLIV_31340Help
Entry
SLIV_31340        CDS       T03222                                 

Definition
(GenBank) secreted alkaline phosphatase
  KO
K01113  alkaline phosphatase D [EC:3.1.3.1]
Organism
slv  Streptomyces lividans
Pathway
slv00790  Folate biosynthesis
slv01100  Metabolic pathways
slv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SLIV_31340
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SLIV_31340
Enzymes [BR:slv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     SLIV_31340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoD PhoD_N Metallophos TAT_signal
Motif
Other DBs
NCBI-ProteinID: AIJ17156
UniProt: D6ER63
Position
complement(6977337..6978926)
Genome map
AA seq 529 aa AA seqDB search
MSQRRPLPGRRGVLRGSLAASAALTLPTALGTAPAFARSGRPGAGWGVQAGDVTSHSGLV
WVRSDRPARMIVETSATESFRHAHRRHGPLLGRDTDFTGTTRLRGLPPGEQIHYRVLLAD
PDDPRRTGEPVTGTFRTVPVRRRDGVRFVWSGDLAGQGWGINPDLGGYRIYDAMGALDPD
FFLCSGDNIYADGPIAETAALPDGGTWRNITTEEKSKVAETLAEFRGNFRYNLLDENLRR
FNAQVPSIVQWDDHEVRNNWYPGQVIADTDDRYTEKRVDVLAARARRAFAEYFPVSSLRP
GAREERVHRVLHQGPLLDVFVLDMRTYRNANSPGEQAVDPQGILGREQLEWLKRELARSR
AVWKVIAADMPIGLVVPDTTEGAPHIEAIAQGDPGAPLGRELQIAELLRFVKHRRITGTV
WLTADVHHTSAQHYQPSRAAFGDFEPFWEFVSGPLNAGAFPASELDGTFGPERVFVKAPT
ASNVSPAGGYQFFGEVDIDGGTAEMTVRLREQDGTVLFTKVLRPGRVGQ
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaacgtcgtccgctgcccggccgccgcggcgtgctgcgcggttcgctcgccgcg
tcggccgccctgaccctgcccaccgccctcgggacggcgccggcgttcgcccgttccggg
cggccgggggcgggctggggcgtgcaggccggagacgtgacctcccactccggtctggtg
tgggtgcggtcggaccggccggcccggatgatcgtcgagacgtccgcgaccgagtcgttc
cgccatgcccaccgccggcacggcccgctgctcgggcgcgacaccgacttcaccggcacc
acccggctgcgcggcctgccgccgggcgagcagatccactaccgtgtgctcctcgccgac
ccggacgacccgcgccgcaccggcgagccggtcaccgggaccttccgcaccgtgccggtc
cgccggcgcgacggcgtgcgcttcgtgtggtccggcgacctcgcgggccagggctggggc
atcaaccccgacctcggcggctaccgcatctacgacgccatgggcgccctggacccggac
ttcttcctgtgcagcggcgacaacatctacgcggacggccccatcgcggagacggccgcc
ctgcccgacggcggcacctggcggaacatcacgaccgaggagaagtccaaggtcgccgag
accctcgccgagttccgcggcaacttccgctacaacctgctcgacgagaacctgcggcgc
ttcaacgcgcaggtcccgtcgatcgtccagtgggacgaccacgaggtgcgcaacaactgg
tacccgggccaggtgatcgcggacacggacgaccggtacaccgagaagcgcgtcgacgtc
ctggcggcccgcgcccggcgcgcgttcgccgagtacttcccggtctcctccctgcgcccc
ggcgcgcgcgaggaacgggtgcaccgggtcctgcaccagggcccgctgctcgacgtgttc
gtcctggacatgcggacgtaccgcaacgccaactcccccggcgaacaggccgtggacccg
cagggcatcctgggccgcgagcagctggagtggctcaagcgggagctggcgcgatcgcga
gccgtgtggaaggtcatcgcggcggacatgccgatcggtctcgtcgtgccggacaccacc
gagggcgcgccccacatcgaggcgatcgcgcagggcgaccccggcgcacccctgggccgc
gagctgcagatcgccgaactgctgcgcttcgtcaagcaccgcaggatcaccggcaccgtg
tggctgacggccgacgtgcaccacacctcggcccagcactaccagccgtcgcgggccgcg
ttcggtgacttcgagccgttctgggagttcgtgtccgggcccctcaacgcgggcgcgttc
ccggccagcgagctggacggcaccttcggtcccgaacgggtcttcgtgaaggcgccgacc
gcctcgaacgtctcccccgcgggcggctaccagttcttcggcgaggtggacatcgacggc
ggcaccgccgagatgacggtgcggctgcgcgagcaggacggcacggtgctgttcacgaag
gtgctgcgaccgggccgggtgggccagtag

DBGET integrated database retrieval system