KEGG   Streptomyces lividans: SLIV_33125Help
Entry
SLIV_33125        CDS       T03222                                 

Gene name
glgA
Definition
(GenBank) Capsular glucan synthase
  KO
K16148  alpha-maltose-1-phosphate synthase [EC:2.4.1.342]
Organism
slv  Streptomyces lividans
Pathway
slv00500  Starch and sucrose metabolism
slv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SLIV_33125 (glgA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:slv01003]
    SLIV_33125 (glgA)
Enzymes [BR:slv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.342  alpha-maltose-1-phosphate synthase
     SLIV_33125 (glgA)
Glycosyltransferases [BR:slv01003]
 Polysaccharide
  Storage polysaccharide
   SLIV_33125 (glgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_trans_1_2 Glyco_transf_5 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AIJ17509
UniProt: D6EVH0
Position
7356032..7357195
Genome map
AA seq 387 aa AA seqDB search
MRVGLLSREFPPDVYGGAGVHVEFLARELARLVDLDVHSWGEGRTDGVLRHRPWSALDGA
NDALRTFSVDLAMTAALEGRELVHSHTWYANLGGHLAKLLHGVPHVVTAHSLEPLRPWKA
EQLGGGYALSGWAERTAFEAADAVIAVSGAMREDILGCYPDLDASRVHVVHNGIDTRLYR
PDHGTDVLDRVGLDRSRPYVLFVGRITRQKGVPQLLRAVRDIDPAAQVVLCAGAPDTPEI
DQEFRDLFAGLSRAREGVHWIPRMLPRTEVIQLLTHAAVFVCPSVYEPLGIVNLEAMACG
TPVVASRVGGIPEVVTDGVTGVLVPREDGADDAFEAGLARALDSVLGDPAGARRMGEAGR
ARAVEEFGWDAVARRTVRLYEEILKQA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgtgggactgctgagccgagagttcccgccggacgtctacggcggcgcgggggtc
catgtcgagttcctcgcccgggagctcgcccgcctcgtcgacctggacgtgcacagctgg
ggcgagggccgcaccgacggcgtgctgcgccaccgcccctggtccgcgctcgacggcgcc
aacgacgcgctgcgcaccttctccgtggacctcgccatgaccgccgccctcgaagggcgc
gaactggtgcactcccacacctggtacgccaacctcggcggccacctcgccaagctcctg
cacggcgtcccgcacgtggtgaccgcccactccctggagcccctgcgcccctggaaggcg
gagcagctcggcgggggctacgcgctgtccggctgggccgagcgcaccgcgttcgaggcg
gccgacgcggtgatcgccgtctccggagccatgcgcgaggacatcctcggctgctacccg
gacctcgacgcctcccgggtccacgtcgtgcacaacggcatcgacacccggctctaccgg
cccgaccacggcaccgacgtgctggacagggtcggcctggaccgctcccgcccgtacgtc
ctgttcgtcggccgcatcacccgtcagaagggcgtgccgcagctgctgcgcgcggtccgg
gacatcgaccccgccgcgcaggtcgtgctgtgcgcgggtgccccggacacccccgagatc
gaccaggagttccgggacctcttcgccgggctgagccgcgcccgcgagggcgtgcactgg
atcccgcgcatgctgccgcgcacggaagtgatccagctcctgacgcacgccgccgtcttc
gtctgcccctccgtctacgagcccctcggcatcgtcaacctggaggcgatggcctgcggc
accccggtggtggcctcccgggtgggcggcatccccgaggtcgtgaccgacggcgtgacg
ggggtactcgtcccgagggaggacggtgcggacgacgccttcgaagcgggcctcgcgcgc
gccctggactccgtcctcggcgatccggcgggcgcccgccggatgggcgaggccggacgg
gcgcgcgcggtggaggagttcggctgggacgcggtcgcgcgccgcacggtccggctgtac
gaggagatcctcaagcaggcttag

DBGET integrated database retrieval system