KEGG   Streptomyces lividans: SLIV_35115Help
Entry
SLIV_35115        CDS       T03222                                 

Definition
(GenBank) polyprenyl synthetase
  KO
K13787  geranylgeranyl diphosphate synthase, type I [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
slv  Streptomyces lividans
Pathway
slv00900  Terpenoid backbone biosynthesis
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Module
slv_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SLIV_35115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:slv01006]
    SLIV_35115
Enzymes [BR:slv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     SLIV_35115
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     SLIV_35115
    2.5.1.29  geranylgeranyl diphosphate synthase
     SLIV_35115
Prenyltransferases [BR:slv01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   SLIV_35115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: AIJ17900
UniProt: D6EDF6
Position
7762427..7763485
Genome map
AA seq 352 aa AA seqDB search
MSDRWDQTGLKTRVDGVLRSFLDEEAAHLAAVDAALAPVADQLRKAAGHGKRLRAAFCYW
GWRAAGQPESDALVRAAASMELVHAAAVVHDDLIDDSRLRHGLPTAHVALEAVLARDGRP
DARTAARSLAMLVGDQLMVLAGLLFTTSGLPAAYLARARDLWAVLARELVAGECLEILHT
GGPPDTGTSLKVVRYKTAKYTVEHPLLIGGLLAGAAPALRDTYRAYALPLGEAFQLRDDL
LGLFGDPERTGKASLDDLRAHRPTALLAETWKAADASQRQWLRRLLGRDDLDATHLHDVR
RLMRELNAPQRVEQMIADRVERATRALDGAGTPPHARRALRELAQQATDRTH
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaccgctgggaccagacgggcctcaaaacccgcgtcgacggggtcctgcggagc
ttcctggacgaggaggccgcccacctggcggcggtcgacgcggccctcgcgcccgtggcc
gaccagctgcggaaggcggccggacacggcaaacggctgcgggcggccttctgctactgg
ggctggcgggcggccggacagcccgagagcgacgcgctcgtacgggcggcggcctccatg
gaactggtgcacgccgccgcggtcgtccacgacgacctcatcgacgacagccgcctgcgc
cacggcctgcccaccgcccacgtcgccctggaagccgtactcgcccgggacggccgcccc
gacgcccgcacggcggcgcggtccctggccatgctggtgggcgatcagctgatggtcctc
gccggcctcctgttcaccaccagcggtctgccggccgcctatctcgcccgcgcccgcgac
ctgtgggccgtgctcgcccgtgaactcgtcgccggcgagtgcctggagatcctgcacacc
ggtggacccccggacaccgggacctccctgaaggtcgtccgctacaagaccgccaagtac
accgtcgagcaccccctgctcatcggcggcctgctggccggcgccgcccccgcgctgcgg
gacacctaccgggcctacgcactgccgctcggggaggccttccagctgcgcgacgacctg
ctcggcctgttcggggacccggaacggaccgggaaggcgagtctggacgacctgcgcgcc
caccggcccaccgcactgctggccgagacctggaaggccgccgacgcgtcccaacggcag
tggctgcgccgcctgctgggccgcgacgacctggacgcgacccacctgcacgacgtgcgc
cggctcatgcgggagctgaacgcgccgcaacgggtcgagcagatgatcgccgaccgtgtg
gagcgggccacccgggccctggacggcgccgggacaccaccgcacgcgcgccgggccctg
cgcgaactcgcccagcaggccaccgaccgcacgcactga

DBGET integrated database retrieval system