KEGG   Streptomyces lividans: SLIV_35650Help
Entry
SLIV_35650        CDS       T03222                                 

Definition
(GenBank) beta-glucosidase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
slv  Streptomyces lividans
Pathway
slv00460  Cyanoamino acid metabolism
slv00500  Starch and sucrose metabolism
slv01100  Metabolic pathways
slv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SLIV_35650
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SLIV_35650
Enzymes [BR:slv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     SLIV_35650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3 Glyco_hydro_3_C Fn3-like
Motif
Other DBs
NCBI-ProteinID: AIJ18006
UniProt: D6EEV8
Position
complement(7890448..7892736)
Genome map
AA seq 762 aa AA seqDB search
MTLPRYRDPAAPVPDRVRDLLGRMTLAEKVGQVNQRMYGWDAYERAGDGHRLTDAFRAEV
AAFDGMGALYGLQRADAWSGVGFADGLDARDGARTAAAVQRYVMDHTRLGIPVLLVEEMP
HGHQALDGTVLPVNLAVGATWDPDLYADAVAGAAAELRARGAHIALVSALDLVRDPRWGR
SEECFSEDPYLAARMTEALVEGARRAGVAVVLKHFAGQGATVGGRNSAATELGPRELHEV
HLAAARAGVAAGAAGVMAAYNEFDGLPCVANRYLLTDLLRTEWGFEGVVMADGTAVDRLV
RLTGDPVSAGALALDAGCDLSLWDASFTRLGEAVERGLVSESALDAAVARVLTLKFRLGL
FEQPLPPARSETVELPDPAELGERIARASVTLLAHEGGVLPLSRAVRRIAVLGPNADSVA
QQIGDYTAPQRPGGGITVLEGIRAAVAAGTEVVHDRGCALVGDDVSDVPAAVALAAGSDV
AVLVLGGSSARSPDTVFDANGAAVTGTGTPSGMTCGEGVDLADLALPPGQRALLTAVSAT
GTPVVVVLVQGRPHALTELDAPAAAVLSAWYPGPRGGRAVAEVLFGDAEPRGRLPVSVPR
SAAQLPVYYNGKDHRYRGYADQSAGPLHAFGHGLSYTSVVYGAPRLSQARVGTRAPRLTC
RVTVRNTGSRPAEETVQLYVRRLSGGSSWPRVRELRGFVRLTIAPGEEAEAVFEVDRDTL
ASVGRDLRLAVEPGLVELETGPASDRTTGVRLEITDSESNAT
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcccgcgctaccgcgacccggccgcgccggtgccggaccgggtccgggacctg
ctgggccgcatgacgctcgcggagaaggtcggccaggtcaaccagcgcatgtacggctgg
gacgcctacgagcgcgccggggacggacaccgcctcaccgatgccttccgcgccgaggtc
gccgccttcgacggcatgggcgcgctgtacgggttgcagcgggccgacgcctggtccggc
gtcggcttcgcggacggcctggacgcacgggacggggcgcggacggcggcggccgtgcag
cggtacgtcatggatcacacccggctgggcatccccgtcctgctggtcgaggagatgccg
cacggccaccaggcgctggacgggacggtgctgccggtgaacctcgcggtcggcgccacc
tgggatccggacctgtacgccgacgcggtggcgggggcggccgccgaactgcgggcgcgc
ggcgcgcacatcgcgctggtctccgcgctcgacctggtgcgcgacccgcggtgggggcgc
agcgaggagtgcttctcggaggatccgtacctcgccgcgcggatgaccgaggcgctggtc
gagggtgcgcggcgggcgggggtggcggtggtcctcaagcacttcgccgggcagggcgcc
acggtcggcggccgcaacagcgcggcgacggagctggggccgcgcgaactgcacgaggtg
cacctggcggcggcccgggccggggtggccgccggtgcggccggggtgatggccgcctac
aacgagttcgacggcctgccctgcgtcgccaaccggtacctgctgaccgacctgctccgt
accgagtggggtttcgagggtgtcgtcatggcggacggcacggcggtggaccggctggtg
cggctgaccggcgatccggtgtcggccggggcgctcgccctggacgccgggtgcgacctg
agcctctgggacgcctcgttcacgcggctgggcgaggcggtggaacgcggtctggtgtcc
gagtcggcgctggacgccgcggtggcgcgggtcctcacgctgaagttccgcctgggcctg
ttcgaacagcctctgcctccggcccggtccgagaccgtggagctcccggaccccgccgag
ctgggcgagcggatcgcccgtgcgtcggtgaccctgctcgcccacgagggcggcgtgctc
cccctgtcccgcgcggtgcggcggatcgcggtgctcggcccgaacgccgactccgtggcg
cagcagatcggcgactacacggcgccgcagcggccaggcggcgggatcaccgtcctggag
ggcatccgggcggcggtggcggccggcaccgaggtggtccacgaccgggggtgcgccctg
gtgggtgacgacgtgtcggacgttcccgccgccgtcgccctggcggccggctccgacgtg
gccgtgctggtgctgggcggctccagcgcccgctccccggacacggtcttcgacgcgaac
ggggcggccgtcaccggtaccgggacgccgtccggcatgacgtgcggcgagggggtcgac
ctggcggacctggcactgccgcccgggcaacgggccctgctgacggcggtgtcggcgacc
gggaccccggtcgtggtggtgctggtccagggccggccgcacgccctgaccgagctggac
gcgcccgcggcggcggtgctgagcgcctggtatcccgggccgcggggcgggcgtgccgtg
gccgaggtgctgttcggcgacgccgagccgcgcggccggctgccggtctccgtgccccgg
tcggccgcccaactgcccgtctactacaacgggaaggaccaccgctaccgcggatatgcc
gaccagagtgccgggccgctgcatgccttcggacacggtctgtcgtacacgagcgtcgtg
tacggggcaccgcgcctgtcgcaggcccgggtcggcacccgcgcaccgcgcctgacctgt
cgggtcacggttcgcaacacggggtcccggcccgccgaggagacggtccagctctacgtg
cgtcggctgtccgggggttcgtcctggccgcgcgtgcgcgagctgcggggcttcgtccgc
ctgaccatcgcacccggcgaggaggccgaggccgttttcgaggtggaccgtgacacgctg
gcctcggtcgggcgcgacctgcggctcgccgtggagccggggctggtcgagctggagacg
ggccccgcgtccgaccggacgacgggcgtccgcctggagataacggactcggaatcgaac
gcaacttag

DBGET integrated database retrieval system