KEGG   Synechococcus lividus: BRW62_00370Help
Entry
BRW62_00370       CDS       T05303                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
slw  Synechococcus lividus
Pathway
slw03010  Ribosome
Brite
KEGG Orthology (KO) [BR:slw00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BRW62_00370
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:slw03011]
    BRW62_00370
Ribosome [BR:slw03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BRW62_00370
  Bacteria
    BRW62_00370
  Archaea
    BRW62_00370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ATS17455
UniProt: A0A2D2PYY6
Position
complement(62974..63342)
Genome map
AA seq 122 aa AA seqDB search
MVSTASPAARASAKYVRMSPHKVRRVLDQLRGQTYRDALIMLRFMPYRACEPITKVLRSA
AANAEHNLGLDPATLVISQAYADQGPSLKRFRPRAQGRAYQIRKPTCHITIAVAAQNTAD
ES
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtttctaccgcttctcctgccgcccgtgcttcagccaaatacgtccgcatgtccccc
cataaggtacggcgggtgctagatcaactccggggacaaacttatcgtgatgccctgatt
atgctgcggtttatgccctatcgtgcctgtgaacccattacaaaggtgctgcgctcggca
gcggctaacgcagagcacaatctggggttagacccagcaaccctagtgatcagccaagcc
tacgcggatcaaggcccttccttaaagcggtttcgcccccgcgctcaaggccgtgcctat
caaattcgcaaaccaacctgccacatcaccattgctgtggctgcccaaaacaccgctgac
gaatcgtag

DBGET integrated database retrieval system