KEGG   Synechococcus lividus: BRW62_00650Help
Entry
BRW62_00650       CDS       T05303                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
slw  Synechococcus lividus
Pathway
slw00471  D-Glutamine and D-glutamate metabolism
slw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    BRW62_00650
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:slw01011]
    BRW62_00650
Enzymes [BR:slw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     BRW62_00650
Peptidoglycan biosynthesis and degradation proteins [BR:slw01011]
 Precursor biosynthesis
  Racemase
   BRW62_00650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ATS17501
UniProt: A0A2D2PZ37
Position
123299..124183
Genome map
AA seq 294 aa AA seqDB search
MDNWYEGTQGLDPTGSIGVFDSGVGGLTVLRALQAQLPRESFLYLADTARLPYGTRSRSE
ILQYVREILTWMQHRGIKMAVMACNTSSALALEQVRHEFSFPILGLIEPAAQAAVTIGKR
IGIIATPATVKSGTYVRVLQECSPHVAIAQVACPEFVPLIESNCLSGERVRRSVRQALAP
LIEFGLDTLVYGCTHYPHLRHIIADYLPSSVHHLDPATTVAHSTAHALKALSLQTVAHQG
HVHFYVSGAPEQFARLASQWLGYYPRTQHLPLSVLSQSYSVEITLPTVPAVVAS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtggacaactggtacgagggaacccaaggactcgatcctacagggtcgattggcgtgttt
gacagcggggtaggtggcctaacggttttacgtgccctacaagctcagttgccaagggag
tcgtttctttaccttgcggatacagcacgacttccctacggcacccgcagccgcagtgag
attctccagtacgtgcgggaaatcctcacgtggatgcagcatcgggggatcaaaatggcc
gtcatggcctgcaataccagttctgcccttgccctagaacaggtgcgccatgaattttcc
tttcccattttgggactcattgaacctgctgctcaggccgctgtcaccattggtaaacgc
attggcattattgcgacccctgccaccgttaaaagtggtacctatgtacgggtactgcag
gagtgctccccccacgtggcgatcgcccaagtggcctgtccggaatttgtgcccttaatt
gaaagtaactgcctcagcggcgagcgagtgcgccgtagtgttcgccaagccttagcccct
ctgattgaatttggactcgacaccttagtgtacgggtgtacccactacccacacctgcgc
cacatcattgcggactaccttcccagttcagttcatcaccttgatccggcgacaactgtt
gcccatagcactgcccatgccctgaaagcgctctctctccagacggttgcgcaccaaggg
cacgttcacttctacgtcagtggtgctccagagcagtttgcccgacttgcctcccagtgg
ttagggtactacccccgcactcaacacctacccctgagtgtcctcagccagtcctatagt
gttgagatcaccctgcccacggtgcctgccgttgttgccagttga

DBGET integrated database retrieval system