KEGG   Synechococcus lividus: BRW62_04720Help
Entry
BRW62_04720       CDS       T05303                                 

Definition
(GenBank) gamma-glutamyltransferase
  KO
K00681  gamma-glutamyltranspeptidase / glutathione hydrolase [EC:2.3.2.2 3.4.19.13]
Organism
slw  Synechococcus lividus
Pathway
slw00430  Taurine and hypotaurine metabolism
slw00460  Cyanoamino acid metabolism
slw00480  Glutathione metabolism
slw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    BRW62_04720
   00460 Cyanoamino acid metabolism
    BRW62_04720
   00480 Glutathione metabolism
    BRW62_04720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slw01002]
    BRW62_04720
Enzymes [BR:slw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     BRW62_04720
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     BRW62_04720
Peptidases and inhibitors [BR:slw01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   BRW62_04720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-ProteinID: ATS18167
UniProt: A0A2D2Q1M9
Position
complement(972491..974197)
Genome map
AA seq 568 aa AA seqDB search
MLHVRFLSWLTVTVGLVILPIRANKAATQNLQAMVVAPHPAAATVGAEVLRAGGNAVDAA
VATALMISVVEPFSAGIGGGGFALVYDASSQDITALDFRERAPLSATPAMYLDSAGNLIP
RASLDGVLAAGTPGTIAGLAALHHRYGKLPWRQLVAPAIHAAEEGFSVTERYRRAATLRL
AVLQADATARQIFLDQGQVPTLGTVIRQPDLAKTLGAIATNPNNFYNGWIATAIADFMGQ
SGGKMSRADLASYQPIWRSPICGRYRGLQVCSMPPPSSGGVTLIQMLNLLQALPPATTPT
DRGHQLASVMQIAYADRAHYLGDSDFVAVPIALLTSPAYAQQRAREILPQQARPQSRVRA
VDPSQLHRPESGNTSHLTVVDTARNAVSLTFTINGAFGAGVVVPQTGILLNNEMDDFAIA
PNQPNLFGVVGVQVNNQPLANGISGGKRPLSSMTPTIVTRDGQLVMAMGSTGGSRIITAV
LQLLLNIIDHGQDAPTALASPRLHQQWEPDVLFVEPGVSPEWLATWQQWGYTVVQPQPWG
NANLIRVLDNGTLEGAADPRGEGIAAGF
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgctccatgttcgatttctgtcttggctgacggttacggtagggttggtcattcttccc
atccgcgccaacaaagcagcaacccagaacctgcaagccatggtggtagcgccccatcca
gcggcggcaaccgtgggggctgaggtgctcagggcagggggaaatgccgtggatgctgcg
gtagctacggcgttgatgatctcggtggtggagccgttttccgcagggattggtggcggt
ggctttgcccttgtctatgatgcctcgtcccaggacattacagccttagattttcgtgag
cgggcgcccttaagcgcaacccctgcgatgtatttagacagtgccggaaatctaattcca
cgagccagcttagatggggtgctagctgctgggacgccaggaacgattgctggtttggct
gctctgcatcatcgctatggtaagctcccttggcggcagcttgttgcacctgcgatccat
gcggcagaagagggatttagcgtcacagaacgctatcggcgagcagcgaccctccgtctt
gcggttctccaagcagatgccactgcccgacagatttttcttgatcaggggcaagtgcca
accctcggcactgttatccgccagccggatttggccaagacgttaggggcgatcgccacc
aatcccaataacttctacaacggttggattgccacagccattgctgatttcatggggcaa
tcagggggaaaaatgagccgcgctgatttggccagttatcaacccatctggcgatcgcca
atctgcggtcgttatcgcggcctccaggtctgttcgatgccgcccccttcctccggtggc
gtgaccctcatccaaatgctgaacctccttcaggcattgccaccggcaaccacacccacc
gatcgcggccatcagctagccagtgtcatgcaaattgcctatgccgatcgcgcccactat
ttaggagatagtgattttgtggcggtacctattgccctcctcactagccctgcctatgcc
caacagcgtgcccgcgagattttaccccaacaggctcgtcctcagagcagggttcgtgcg
gttgatccgagccaattgcatcgccccgagtcaggtaatactagccacctgactgtggtg
gataccgctcgcaatgctgtgagccttacctttaccattaatggtgcctttggtgctggc
gtagttgtcccccagacgggcattctccttaacaatgaaatggacgacttcgcgatcgcc
cctaatcagcccaatctctttggtgtggttggggtacaggtcaacaatcaaccccttgct
aacggcattagcggtggcaagcgtcccctctctagcatgaccccaaccattgttacccgc
gatggccaactggttatggccatgggttccacagggggcagccgcattatcactgcggtg
ctgcaactcttgctcaatatcattgaccacggacaggacgcgcccacggctctggctagt
cctcgcctgcaccagcagtgggagccagatgttttgtttgttgaacctggggtatcccca
gaatggctagccacatggcagcagtggggctataccgtggtacaaccgcagccctggggc
aatgccaacctcatccgcgtgctagataatggaaccttagaaggagctgcggatcctcgc
ggtgaggggattgcagctggattttga

DBGET integrated database retrieval system