KEGG   Synechococcus lividus: BRW62_09670Help
Entry
BRW62_09670       CDS       T05303                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
slw  Synechococcus lividus
Pathway
slw00520  Amino sugar and nucleotide sugar metabolism
slw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BRW62_09670
Enzymes [BR:slw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     BRW62_09670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 3Beta_HSD Polysacc_synt_2 RmlD_sub_bind adh_short KR NmrA NAD_binding_10 DUF1815 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ATS18964
UniProt: A0A2D2Q375
Position
2043471..2044427
Genome map
AA seq 318 aa AA seqDB search
MRILVTGGAGFIGSHLVDRLMEAGHEVICLDNYFTGTKRNILRWLGHPNFELIRHDVTDP
IRLEVDQIYHLACPASPVHYQYNPVKTIKTNVMGTLHMLGLAKRVKARFLLASTSEVYGD
PLVHPQSESYWGHVNPIGIRSCYDEGKRVAETLAFDYHRQNNVAVRVARIFNTYGPKMQV
NDGRVVSNFIVQALQGIPLTVYGDGSQTRSFCYVSDLVEGLIRLMNSEHTGPVNLGNPDE
YTVLELAQKIQALINPSAEIQFKPLPSDDPQRRRPDITVARTLLDWQPSVPLSEGLRRTI
PDFAERLGVPYTPMMVEV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattcttgtaaccggcggcgcgggttttattggttcccatcttgtggatcggctg
atggaggctggccacgaggtgatttgcttagataattattttaccggcactaagcgcaat
atcctacggtggctgggtcaccccaactttgagctgattcgccatgatgtcaccgaccct
atccgtcttgaggtcgatcagatttaccacctcgcctgccccgcctcgccggtgcattac
cagtacaatccggtcaaaaccattaaaaccaacgtcatgggcaccctccacatgctaggg
ctagccaagcgagtcaaggcacggttcctgttggcctccacgtcagaagtctatggcgat
ccgctggtgcatcctcaatcagagtcctactgggggcatgtgaaccccattggtattcgc
tcgtgctatgacgagggcaagcgggttgctgaaaccctcgcctttgactaccaccgtcaa
aacaatgtagcggtacgagtagcacggatttttaacacctatggcccgaaaatgcaggtt
aatgatggccgcgttgtcagtaattttattgtgcaagcgttgcagggaattcccctcacg
gtctatggtgatggctctcagacccgtagcttttgttacgtcagcgatttagtcgaagga
ctcattcggttgatgaacagcgagcataccggccccgtgaacttggggaaccctgacgaa
tatacggttctggagctcgcccaaaaaattcaagccctgattaaccccagtgctgagatt
cagtttaagcccctccccagtgatgacccgcaacgccgccgccccgatattacggtggcg
cgaaccctgttggactggcagccgagtgtgccgctatcggagggtctgcgccgcacgatt
ccagactttgccgagcggttaggggtgccctatacgcctatgatggtcgaagtttag

DBGET integrated database retrieval system