KEGG   Streptomyces lavendulae: SLAV_07110Help
Entry
SLAV_07110        CDS       T05314                                 

Gene name
icd
Definition
(GenBank) Isocitrate dehydrogenase [NADP]
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
slx  Streptomyces lavendulae
Pathway
slx00020  Citrate cycle (TCA cycle)
slx00480  Glutathione metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
slx01130  Biosynthesis of antibiotics
slx01200  Carbon metabolism
slx01210  2-Oxocarboxylic acid metabolism
slx01230  Biosynthesis of amino acids
Module
slx_M00009  Citrate cycle (TCA cycle, Krebs cycle)
slx_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SLAV_07110 (icd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SLAV_07110 (icd)
Enzymes [BR:slx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     SLAV_07110 (icd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: ATZ23326
UniProt: A0A2K8P9C8
Position
complement(1574716..1576935)
Genome map
AA seq 739 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVIQAYASTAGVNVETRDISLAGRIIASFPEHLEESQ
RIADALAELGELAKTPEANIIKLPNISASIPQLKAAIAELQGQGYALPDYPDDPKSDEER
EIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTSESKTNVATMGEND
FRSTEKSTVIAEAGALRIEHVAADGAVTVLRDSVPVLAGEVVDASVLHVDALRTFLNDQI
ERAKAEGVLFSVHLKATMMKVSDPIIFGHVVRAFLPKTFARYGETLAAAGLSPNDGLGTI
LNGLGALADGDAIKASIDAEIAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSGH
MWGPDGAEADTLAVLPDSSYAGVYQVVVDDCRAHGAFDPATMGSVPNVGLMAQKAEEYGS
HDKTFEIASAGTVRLVDAAGNTVLEQEVAAGDIFRACQTKDAPIQDWVKLAVTRARATGV
PAVFWLDEGRAHDAQLIAKVKTYLADHDTDGLTIEILSPVKATAYSLERIRRGEDTISVT
GNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRWD
SLGEFLALAVSFEHLATTTGNARAQVLADTLDRATGTFLNEDKSPSRKLGGIDNRGSHFY
LALYWAQELSRQIDDPKLAAAFEPLAKTLAESEETIVRELIAVQGSPAEIGGYYQPDPAK
AAEIMRPSATLNKALGLLG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctacacgcacactgacgaggccccggccctcgcgacgtat
tccttcctgcctgtcatccaggcgtacgcgtcgacggccggtgtgaatgtcgagacccgt
gacatctccctggccggtcggatcatcgccagcttccccgagcaccttgaggagagccag
cggatcgccgacgccctcgccgagctcggcgagctggcgaagacgccggaagcgaacatc
atcaagctgcccaacatctcggcttcgatcccgcagctgaaggccgcgatcgccgagctc
cagggccagggctacgcccttccggactacccggacgacccgaagtccgacgaggagcgc
gagatccgcgcccgctacgacaaggtcaagggcagcgccgtcaacccggtcctgcgcgag
ggcaactccgaccgccgcgcccccgcctcggtgaagaactacgccaaggcccacccgcac
cgcatgggcgcctggacctccgagtcgaagacgaacgtcgccaccatgggcgagaacgac
ttccgctccaccgagaagtccaccgtgatcgccgaggccggcgcgctccgcatcgagcac
gtcgccgccgacggcgccgtcaccgtcctgcgcgactccgtaccggtcctcgccggtgag
gtcgtggacgcgtccgtcctgcacgtcgacgccctgcgcaccttcctcaacgaccagatc
gagcgggccaaggccgagggcgtcctgttctccgtgcacctcaaggccacgatgatgaag
gtctccgacccgatcatcttcggccacgtggtccgcgccttcctcccgaagacgttcgcc
cgctacggcgagaccctcgccgccgccggcctgtcccccaacgacggcctcggcaccatc
ctgaacggcctcggcgccctcgccgacggcgacgcgatcaaggcctcgatcgacgccgag
atcgccgagggcccggccctggcgatggtcgactccgacaagggcatcaccaacctgcac
gtgccgtccgacgtcatcgtcgacgcctcgatgccggccatgatccgcacctccggccac
atgtggggcccggacggcgccgaggccgacaccctcgccgtcctcccggacagcagctac
gcgggcgtctaccaggtcgtcgtcgacgactgccgcgcccacggcgccttcgacccggcc
accatgggctcggtgccgaacgtcggcctgatggcccagaaggccgaggagtacggcagc
cacgacaagaccttcgagatcgcgagcgccggcaccgtccgcctcgtcgacgccgcgggc
aacacggtcctggagcaggaggtcgccgccggtgacatcttccgcgcctgccagaccaag
gacgcgccgatccaggactgggtcaagctcgccgtcacccgcgcccgcgccaccggcgtc
ccggccgtcttctggctcgacgagggccgcgcgcacgacgcgcagctgatcgccaaggtc
aagacgtacctggccgaccacgacaccgacggtctcaccatcgagatcctgtccccggtc
aaggccaccgcgtactccctggagcgcatccgccgcggcgaggacaccatctcggtgacc
ggcaacgtgctgcgcgactacctgaccgacctcttccccatcctggagctgggcaccagc
gccaagatgctgtcggtcgtcccgctgatgaacggcggcggcctcttcgagaccggcgcc
ggcggctccgcccccaagcacgtccagcagctggtcaaggagaactacctgcgctgggac
tccctcggtgagttcctcgcgctggccgtctccttcgagcacctcgccaccaccaccggc
aacgcccgcgcccaggtgctggccgacaccctggaccgcgcgaccggcaccttcctcaac
gaggacaagtcgccgagccgcaagctgggcggcatcgacaaccgcggcagccacttctac
ctggccctgtactgggcccaggagctgtcccgccagatcgacgacccgaagctcgccgcg
gccttcgagccgctcgccaagaccctggcggagtccgaggagaccatcgtccgcgagctc
atcgcggtccagggctccccggccgagatcggcggctactaccagcccgacccggccaag
gcagccgagatcatgcgtccctccgcgacgctgaacaaggcgctcggcctcctcggctga

DBGET integrated database retrieval system