KEGG   Streptomyces lavendulae: SLAV_09110Help
Entry
SLAV_09110        CDS       T05314                                 

Gene name
metG2
Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
slx  Streptomyces lavendulae
Pathway
slx00450  Selenocompound metabolism
slx00970  Aminoacyl-tRNA biosynthesis
slx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SLAV_09110 (metG2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SLAV_09110 (metG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slx01007]
    SLAV_09110 (metG2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slx03016]
    SLAV_09110 (metG2)
Enzymes [BR:slx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SLAV_09110 (metG2)
Amino acid related enzymes [BR:slx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SLAV_09110 (metG2)
Transfer RNA biogenesis [BR:slx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SLAV_09110 (metG2)
 Prokaryotic type
   Other AARSs
    SLAV_09110 (metG2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Auto_anti-p27 tRNA-synt_1e
Motif
Other DBs
NCBI-ProteinID: ATZ23691
UniProt: A0A2K8PAD2
Position
complement(2131073..2132647)
Genome map
AA seq 524 aa AA seqDB search
MSTPVWITATPPATHGELHVGHLAGPYVAADVLSRYLRAEGEPVLFTTGTADHTSSVHVR
ALRAGRKPEEVAEGYRAAITADWLRSGVEFDHIVRPRQDRGYARWLGDLFRRLYADGVIA
ARTRLTPWCEPCGRFLHGAHVTGSCPHCAAVSDGGMCHECARPNDGGDLLGAHCAQCGTP
AVPKRCRRLYIPLEPHREALAEYWAATGLPPRLAALCESLVEDGLPDIAVAHPAEWGLPV
PVDGFPEHRIDGCFEAAAMQLFGHGERPLPERAIHFCGFGHAFCHAVLLPVLLFARGVKL
PQHFCVNEAYVIEDEALVWGTGRKAWALDLITEYGSDTLRRHVLEARPLGRRTAFDPDRL
AAARRELDESWNSWLSRLFTAVREQSSGRVPEALPGGTGWQVLERRLLRGLEDLREAYSP
EAFDPRRAVALLDEMVRSVSDFGHVNAHEAHRPAADGRYLPVLAAQLAVARALAAWARPV
MPEGADRLAAALRTHAGGPVRSEVLTPPAPGTRLAPPSGPVFGF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgtctggatcaccgcgaccccgccggccacccacggcgaacttcacgtc
ggccacctcgccggaccgtacgtcgcggcggacgtgctgtcccggtacctcagggccgag
ggcgaacccgtcctgttcaccactggtaccgccgaccacaccagctccgtccacgtccgg
gcgctgcgcgccggccgcaagccggaggaggtggccgaggggtaccgcgccgcgatcacg
gcggactggctgcgctcgggagtcgagttcgaccacatcgtccgtccgcgccaggaccgg
ggctacgcgcgctggctgggcgacctcttccggcggctgtacgcggacggggtcatcgcc
gcccgcacccgcctcaccccctggtgcgaaccctgcgggcgttttctccacggagcgcac
gtcaccggctcctgcccgcactgcgcggccgtcagcgacggcggcatgtgccacgagtgc
gcccgccccaacgacggcggggacctgctgggtgcgcactgcgcacagtgcggcaccccg
gccgtgccgaagcgctgccggcgcctgtacatcccgctggagccgcaccgcgaggccctc
gccgagtactgggccgccaccgggctgccgccgcgcctggccgcactgtgcgagtcgctc
gtcgaggacgggctgccggacatcgcggtggcccaccccgccgagtgggggctgcccgta
ccggtggacggattccccgaacaccgtatcgacggctgcttcgaggccgccgcgatgcag
ctgttcggtcacggcgagcgcccgctgcccgagcgggccatccacttctgcggcttcggc
cacgccttctgccacgccgtcctgctgccggtcctgctgttcgcccggggcgtcaagctg
ccgcagcacttctgcgtgaacgaggcgtacgtcatcgaggacgaggcgctggtctggggc
accggccggaaggcctgggcgctggacctgatcaccgagtacgggtcggacaccctgcgc
cggcacgtccttgaggcccggccgctgggccgccgcaccgccttcgacccggaccggctc
gcggccgcccgccgcgaactggacgagagctggaacagctggctgtcccggctgttcacc
gccgtgcgcgagcagagctccgggcgtgtgccggaggcgctgcccggcggcaccggctgg
caggtgctggaacgcaggctgctgcgcgggctggaggacctgcgggaggcctactcgccg
gaggccttcgacccccgcagggcggtcgcgctgctcgacgagatggtgcggtcggtgtcc
gacttcggccacgtcaacgcgcacgaggcgcaccgccccgccgccgacggccggtacctg
ccggtgctcgcggcccagctggccgtggcccgcgcgctcgccgcctgggcccgcccggtg
atgccggagggcgccgaccggctcgccgcggccctgcggacgcacgcggggggcccggtc
cggtccgaggtgctcaccccgcccgcgccgggcacccggctggccccgccctcgggcccg
gtgttcggcttctga

DBGET integrated database retrieval system