KEGG   Streptomyces lavendulae: SLAV_21685Help
Entry
SLAV_21685        CDS       T05314                                 

Gene name
hemL2
Definition
(GenBank) Glutamate-1-semialdehyde 2,1-aminomutase 2
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
slx  Streptomyces lavendulae
Pathway
slx00860  Porphyrin and chlorophyll metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
Module
slx_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLAV_21685 (hemL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slx01007]
    SLAV_21685 (hemL2)
Enzymes [BR:slx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     SLAV_21685 (hemL2)
Amino acid related enzymes [BR:slx01007]
 Aminotransferase (transaminase)
  Class III
   SLAV_21685 (hemL2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ATZ26154
UniProt: A0A2K8PHD8
Position
4871408..4872730
Genome map
AA seq 440 aa AA seqDB search
MAGVSYPYPYEAPVSQTLFERASLVTPGGVNSPVRAFRAVGGTPRFMVSGTGPYLTDADG
REYVDLVCSWGPMILGHSHPEVIEAVQAAVARGTSFGTPGEGEVALAEEIVARIEPVEQV
RLVSSGTEATMSAIRLARGFTGRAKVVKFAGCYHGHVDALLAAAGSGLATFALPDTPGVT
GAQAGDTIVLPYNDLDAVRAAFAAHPGEIACVITEAAPGNMGVVTPGEGFNQGLADLCRE
NGALYISDEVMTGFRTSRAGWYGVDGVKPDLMTFGKVMGGGFPAAAFGGRADVMGHLAPA
GPVYQAGTLSGNPIATAAGLAQLRLLDAAAYEKVDAVSREIQGLVTAALAKEGVAHRLQT
ASNMFSVFFTEDEVRNYDDAKKQEGFRFNGFFHSMLAQGVYLPPSAFESWFVSTAHDERA
VERIAAALPAAARAAAEATA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggctggtgtgagctacccgtacccgtatgaagccccagtttcgcagacgctcttcgag
cgcgcgtccctcgtgacccccggcggcgtgaactctcccgtgcgcgccttccgtgccgtg
ggcggtacgccccggttcatggtgtccggtaccggtccctatctgaccgatgccgacggg
cgcgagtacgtcgacctggtctgctcgtgggggccgatgatcctcggccactcccacccc
gaggtgatcgaggccgtgcaggccgcggtcgcccgcggcacctccttcggcacgcccggc
gagggcgaggtcgcgctcgccgaggagatcgtcgcccgtatcgagcccgtcgagcaggtg
cgcctggtgtcctcgggcaccgaggcgaccatgtcggcgatccggctggcccgcggcttc
accggccgcgccaaggtcgtgaagttcgccggctgctaccacggacacgtcgacgcgctg
ctggccgccgccggttccggcctggcgaccttcgccctgccggacacccccggtgtgacc
ggcgcgcaggccggcgacacgatcgtgctcccctacaacgacctcgacgcggtgcgggcg
gcgttcgccgcgcacccgggcgagatcgcctgcgtgatcaccgaggccgcgcccggcaac
atgggcgtggtgaccccgggcgagggcttcaaccaggggctggccgacctgtgccgggag
aacggcgcgctgtacatctccgacgaggtgatgaccggtttccgtacctcccgcgcgggc
tggtacggcgtggacggggtcaagcccgacctgatgaccttcggcaaggtcatgggcggc
ggcttcccggcggccgccttcggcggccgtgcggacgtcatgggccacctggccccggcg
ggtccggtgtaccaggcgggcacgctctccggaaacccgatcgccaccgcggccggtctg
gcgcagctgcggctgctggacgcggcggcgtacgagaaggtcgacgcggtctcccgggag
atccagggcctggtgacggcggcgctggccaaggagggtgtggcgcaccggctgcagacg
gcctccaacatgttctcggtgttcttcaccgaggacgaggtccgcaactacgacgacgcg
aagaagcaggaagggttccgcttcaacgggttcttccactcgatgctggcgcagggcgtc
tacctgccgccgtcggcgttcgagtcgtggttcgtctccaccgcccacgacgagcgcgcc
gtcgagcgcatcgcggccgcgctgcccgcggccgcccgagccgccgcggaggcgaccgca
tga

DBGET integrated database retrieval system