KEGG   Streptomyces lavendulae: SLAV_24525Help
Entry
SLAV_24525        CDS       T05314                                 

Gene name
ndkA
Definition
(GenBank) Nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
slx  Streptomyces lavendulae
Pathway
slx00230  Purine metabolism
slx00240  Pyrimidine metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01130  Biosynthesis of antibiotics
Module
slx_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
slx_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
slx_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    SLAV_24525 (ndkA)
   00240 Pyrimidine metabolism
    SLAV_24525 (ndkA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slx04131]
    SLAV_24525 (ndkA)
Enzymes [BR:slx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     SLAV_24525 (ndkA)
Membrane trafficking [BR:slx04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    SLAV_24525 (ndkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ATZ26705
UniProt: A0A2K8PM48
Position
5511049..5511459
Genome map
AA seq 136 aa AA seqDB search
MTQRTLVILKPDAVRRGLIGEIIGRIERKAGWTVPALELRTLDRQTLETHYAEHVGRPFY
EPLMGFMESGPVVVLVVEGERVIEGVRQLAGPTDPIAAAPGSIRGDFGTVTRENLIHASD
SEESAERELKLFFPSL
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcgcacgctcgtcatcctgaagccggacgctgtccgtcgcggcctgatcggc
gagatcatcggccggatcgagcggaaggccggctggaccgttcccgcgctggagctgcgc
acgctggaccgtcagacgctggagacgcactacgccgagcacgtggggcgcccgttctac
gagcccctcatgggcttcatggagagcggcccggtcgtcgtcctcgtggtcgaaggggaa
cgcgtgatcgagggtgtccgccagctggccgggcccaccgacccgatcgccgcggcgccc
ggttccatccggggcgacttcggcaccgtcacccgggagaacctgatccacgcctcggat
tccgaggagtccgcggagcgcgagctgaagctcttcttcccctccctctga

DBGET integrated database retrieval system