KEGG   Streptomyces lavendulae: SLAV_30305Help
Entry
SLAV_30305        CDS       T05314                                 

Gene name
puuC
Definition
(GenBank) Aldehyde dehydrogenase PuuC
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
slx  Streptomyces lavendulae
Pathway
slx00010  Glycolysis / Gluconeogenesis
slx00053  Ascorbate and aldarate metabolism
slx00071  Fatty acid degradation
slx00280  Valine, leucine and isoleucine degradation
slx00310  Lysine degradation
slx00330  Arginine and proline metabolism
slx00340  Histidine metabolism
slx00380  Tryptophan metabolism
slx00410  beta-Alanine metabolism
slx00561  Glycerolipid metabolism
slx00620  Pyruvate metabolism
slx00625  Chloroalkane and chloroalkene degradation
slx00903  Limonene and pinene degradation
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
slx01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SLAV_30305 (puuC)
   00053 Ascorbate and aldarate metabolism
    SLAV_30305 (puuC)
   00620 Pyruvate metabolism
    SLAV_30305 (puuC)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SLAV_30305 (puuC)
   00561 Glycerolipid metabolism
    SLAV_30305 (puuC)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SLAV_30305 (puuC)
   00310 Lysine degradation
    SLAV_30305 (puuC)
   00330 Arginine and proline metabolism
    SLAV_30305 (puuC)
   00340 Histidine metabolism
    SLAV_30305 (puuC)
   00380 Tryptophan metabolism
    SLAV_30305 (puuC)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SLAV_30305 (puuC)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SLAV_30305 (puuC)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SLAV_30305 (puuC)
Enzymes [BR:slx01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SLAV_30305 (puuC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC Cohesin
Motif
Other DBs
NCBI-ProteinID: ATZ27838
UniProt: A0A2K8PMY4
Position
6751938..6753422
Genome map
AA seq 494 aa AA seqDB search
MTQRVLSDRPLANPGKLFIGGRWIPARDGRTEPDVSPIDGQEIVPVAQASAADADAAVTA
ARTAYEEGPWSRLSAQERALRLNRVGELIERDLEEIALLETVDMGKPFAFSSTVDAPMAA
QLMHYYAGAVTRVDGSSRAPAGGQLAYTLREPLGVVCAITPFNFPLLLSMTKIAPALAAG
NTVVHKPSPATPLTALKIAELFQEAEIPDGVLNVITGPGVELGETLTDHPGIDKIAFTGS
TAVGQSIIRKSAGTLKKVTMELGGKSANIVFADADLDAAEELAFFGIYYNKGEICTAGSR
LLLQRPIHDELVERLVRRAAALRPGDPRDPGTLFGPLAHQGQFDKVSSYIEVGEKEGAVL
RAGGAGWTPEGASSRGLYFLPTVFTGVDNSMRIAQEEIFGPVLSIIPFDTEEDAVRIAND
SAYGLAAGVHTKDLRRAHRVASQIKAGTVWVNCYNQYDPSVPYGGYKASGYGRECGPESL
ESYTQTKSVWIGMD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcgcgtgctcagcgaccgacctctggccaaccccgggaagctgttcatcggc
ggcagatggatccccgcccgggacggccgtaccgaaccggacgtcagcccgatcgacggg
caggagatcgtaccggtggcccaggcctccgcggccgacgcggacgccgccgtcaccgcg
gcccgcacggcctacgaggaaggtccctggagccggctctccgcccaggagcgcgcgctg
cggctcaaccgcgtcggcgaactgatcgagcgggacctggaggagatcgcgctgctggag
acggtggacatgggcaagccgttcgccttctccagcaccgtcgacgcccccatggccgcc
cagctgatgcactactacgccggcgcggtcacccgcgtcgacggctcctcccgggccccg
gcgggcggacagctcgcgtacacgctgcgcgaaccgctgggcgtggtctgcgccatcacc
cccttcaacttcccgctcctgctgtcgatgacgaagatcgccccggccctcgcggccggg
aacaccgtcgtccacaagccctccccggccactccgctcaccgccctgaagatcgccgag
ctcttccaggaggcggagatccccgacggggtgctgaacgtcatcaccggtcccggcgtg
gaactgggggagaccctcacggaccaccccggcatcgacaagatcgccttcaccggctcc
accgcggtcggccagtcgatcatccgcaagtcggccggcaccctgaagaaggtgacgatg
gaactcggcggcaagtccgccaacatcgtcttcgccgacgccgacctcgacgccgccgag
gaactcgccttcttcggcatctactacaacaagggcgagatctgcaccgccggctcccgg
ctgctgctccagcggcccatccacgacgagctggtcgaacgcctggtgcgccgggccgcc
gccctcaggccgggggacccgcgcgatcccggcaccctcttcggacccctggcccaccag
ggccagttcgacaaggtcagctcctacatcgaggtcggcgagaaggaaggcgcggtactg
cgcgccggaggcgccggctggacccccgagggcgcctccagcaggggcctgtacttcctg
ccgaccgtcttcaccggggtcgacaactccatgcggatcgcccaggaggagatcttcggg
cccgtcctgtcgatcatccccttcgacaccgaggaggacgccgtacgcatcgccaacgac
agcgcgtacggcctcgccgccggggtccacaccaaggacctgcggcgggcccaccgggtc
gcctcgcagatcaaggcgggcacggtctgggtgaattgctacaaccagtacgacccctcc
gtgccctacggcggctacaaggcctccggctacggacgcgagtgcggccccgaatccctg
gagagctacacgcagaccaagtcggtctggatcgggatggactga

DBGET integrated database retrieval system