KEGG   Streptomyces lavendulae: SLAV_32320Help
Entry
SLAV_32320        CDS       T05314                                 

Gene name
ltaE2
Definition
(GenBank) Low specificity L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
slx  Streptomyces lavendulae
Pathway
slx00260  Glycine, serine and threonine metabolism
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
slx01120  Microbial metabolism in diverse environments
slx01130  Biosynthesis of antibiotics
slx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SLAV_32320 (ltaE2)
Enzymes [BR:slx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SLAV_32320 (ltaE2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ATZ28236
UniProt: A0A2K8PNA3
Position
7199351..7200427
Genome map
AA seq 358 aa AA seqDB search
MRTDTGKTDARRHHDPAVRGFASDNYAGVHPEVLAAVALANGGHQVSYGEDEYTEHLQKI
FRSHFGPSAQAFPVFNGTGANVTALQAMTDRWGAVICAKTAHINVDEGGAPERMAGIKLL
AVPTPDGKLTPELIDQEAWGFEDEHRAMPQVVSITQNTELGTVYTRDEIKAICDHAHGLG
MKVHLDGARIANAAASLDLPMRTFTNTVGVDVLSYGGTKNGMMFGEAVVVLNPDAVRQMK
HIRKMSMQLASKMRFVSVQLEALLAKDLWLRNARHANAMAQRLAAGVRETDGVEILYPVQ
ANAVFARLPHEVTRRLQQRYRFYFWDEAAGDVRWMCGFDTQEEDVDGFLQALKEELAR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgaggaccgataccggcaagaccgatgcccggcgtcaccacgacccggccgtgcgcgga
ttcgccagcgacaactacgcgggcgtgcaccccgaggtgctcgccgccgtcgcgctcgcc
aacggcggccaccaggtctcctacggcgaggacgagtacaccgaacacctgcagaagatc
ttccgcagtcacttcgggccgtccgcgcaggccttcccggtcttcaacggcacgggtgcc
aacgtcaccgccctccaggccatgaccgaccgctggggcgcggtgatctgcgccaagacc
gcccacatcaacgtggacgagggcggcgcgcccgagcggatggcgggcatcaagctgctc
gccgtaccgacgccggacggcaagctcacccccgagctgatcgaccaggaggcctggggc
ttcgaggacgagcaccgggcgatgccgcaggtcgtctcgatcacgcagaacaccgagctc
ggcacggtctacacccgggacgagatcaaggcgatctgcgaccacgcgcacggcctcggc
atgaaggtgcacctcgacggtgcccggatagccaacgccgcggcctccctcgacctgccg
atgcgcaccttcaccaacacggtgggcgtggacgtgctgtcctacggcggcacgaagaac
ggcatgatgttcggcgaggccgtggtggtgctgaacccggacgcggtccggcagatgaag
cacatccgcaagatgtcgatgcagctcgcctccaagatgcggttcgtctcggtgcagctg
gaagcgctgctcgcgaaggacctgtggctgcgcaacgcccgccacgccaacgcgatggcg
cagcggctcgccgccggtgtgcgcgagaccgacggggtggagatcctctacccggtgcag
gccaacgccgtcttcgcgcggctgccgcacgaggtcacgcgccggctccagcagcggtac
cgcttctacttctgggacgaggcggccggtgacgtccgctggatgtgcggcttcgacacc
caggaagaggacgtggacggcttcctccaggcgctcaaggaggagctggcccgctag

DBGET integrated database retrieval system