KEGG   Streptomyces lavendulae subsp. lavendulae: SLAV_40480
Entry
SLAV_40480        CDS       T05314                                 

Gene name
arnB2
Definition
(GenBank) UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase
  KO
K13329  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase [EC:2.6.1.110]
Organism
slx  Streptomyces lavendulae subsp. lavendulae
Pathway
slx00523  Polyketide sugar unit biosynthesis
slx01100  Metabolic pathways
slx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slx00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SLAV_40480 (arnB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slx01007]
    SLAV_40480 (arnB2)
Enzymes [BR:slx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.110  dTDP-4-dehydro-2,3,6-trideoxy-D-glucose 4-aminotransferase
     SLAV_40480 (arnB2)
Amino acid related enzymes [BR:slx01007]
 Aminotransferase (transaminase)
  Others
   SLAV_40480 (arnB2)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Aminotran_5
Other DBs
NCBI-ProteinID: ATZ29858
UniProt: A0A2K8PTS7
Position
pSA3239:223772..224929
AA seq 385 aa
MINLFQPQVGAEELDAVAQVFQDHWLGHGPRTKAFEAAFAEHLGVAPEHVVFINSGTSGL
FLATELLDLEEGDEVVLPSLSFLAAANAIMTSGGRPVFCDVDPRTLNPTLDDIEQVLTDR
TKAVIVLHYGGYPGDIVRIAERCRELGITLIEDSACSVASRVDGRAVGTFGDLAMWSFDA
MKVLVTGDGGMIYVKDPEQAARVRRLAYHGLAQPSGFGYAKVSARWWELDIPEPGRRVIG
NDLTAAIGSVQLRRLPEMVTRRQEIVALYDRELAGIEGLLTPPELPEGHESTHYFYWVQM
SPEIRDQVASDLLADEIYTTFRYAPLHKVPTYGTPDTRLPSSDWVSDRTLCLPLHPGLSD
ADVLTVAASLRKAVEARTAEKNARS
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgatcaatctcttccagccccaggtgggtgctgaggaactcgacgctgttgcccaggtg
ttccaggaccactggctcggccacggcccccgcaccaaggccttcgaggcggccttcgcc
gagcacctcggcgtcgcacccgaacacgtggtgttcatcaactcgggcacgtcggggctc
ttcctggccacggaactgctggacctggaggagggcgacgaggtcgtcctgccctcgctc
agcttcctcgccgccgccaacgcgatcatgaccagcggtggccgcccggtcttctgtgac
gtcgacccccgcaccctcaaccccacgctcgacgacatcgaacaggtcctcaccgaccgc
accaaggcggtgatcgtcctccactacggcggctaccccggcgacatcgtccgcatcgcg
gaacgctgccgcgagctcggcatcaccctcatcgaggactccgcctgctcggtggcctcc
cgcgtcgacggcagggccgtgggcaccttcggcgacctcgccatgtggagcttcgacgcc
atgaaggtcctcgtcaccggcgacggcggcatgatctacgtcaaggatcccgagcaggcc
gcgagggtccgtcgcctcgcctaccacggcctcgcccagcccagcggcttcggctacgcc
aaggtctccgcccgctggtgggaactggacatccccgagcccgggcgccgcgtcatcggc
aacgacctgaccgccgccatcggctccgtccaactgcgcaggctccccgagatggtgacc
aggcgccaggagatcgtcgccctctacgaccgggagctcgccggcatcgaaggcctgctc
actcccccggaactccccgagggccacgagtccacccactacttctactgggtgcagatg
tcccccgagatccgcgaccaggtcgcatccgacctgctggcggacgagatctacacgacg
ttccgctacgcccctctgcacaaggtcccgacgtacggtacgcccgacacccggctcccc
tcctcggactgggtctccgaccgtacgctgtgcctcccgctgcaccccggcctcagcgac
gccgacgtgctcaccgtcgccgcttccctgcgcaaggccgtcgaggcccgcaccgcggag
aagaacgcccggtcctga

DBGET integrated database retrieval system