KEGG   Solanum lycopersicum (tomato): 100736432Help
Entry
100736432         CDS       T02665                                 

Gene name
CyP
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase
  KO
K01802  peptidylprolyl isomerase [EC:5.2.1.8]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100736432 (CyP)
Enzymes [BR:sly01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     100736432 (CyP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 100736432
NCBI-ProteinID: NP_001234488
UniProt: P21568
Position
1
AA seq 171 aa AA seqDB search
MANPKVFFDLTIGGAPAGRVVMELFADTTPKTAENFRALCTGEKGVGKMGKPLHYKGSTF
HRVIPGFMCQGGDFTAGNGTGGESIYGAKFNDENFVKKHTGPGILSMANAGPGTNGSQFF
ICTAKTEWLNGKHVVFGQVVEGMDVIKKAEAVGSSSGRCSKPVVIADCGQL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatccaaaggttttctttgaccttaccatcggtggtgcaccagctggtcgtgtg
gtgatggagctcttcgccgataccactcccaaaaccgctgagaacttccgagctctttgt
accggtgagaaaggtgttggaaagatggggaagcctttgcactacaagggctcaaccttc
caccgtgtgatcccagggttcatgtgtcaaggaggtgatttcaccgccggaaacgggacc
ggaggagagtcgatctatggagccaaattcaacgatgagaacttcgttaagaagcacacc
ggccctggaatcctctccatggctaatgctggacctggaaccaacggttctcagtttttc
atctgtaccgctaagactgagtggctcaacggaaagcacgtcgtgtttggacaagttgtt
gaaggcatggatgtgattaagaaggcagaggctgttggatctagctctggaaggtgctcc
aagcctgtggttattgctgactgcggtcaactctag

DBGET integrated database retrieval system