KEGG   Solanum lycopersicum (tomato): 100750253
Entry
100750253         CDS       T02665                                 

Gene name
HYD2
Definition
(RefSeq) delta14-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00100  Steroid biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Module
sly_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100750253 (HYD2)
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     100750253 (HYD2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 100750253
NCBI-ProteinID: NP_001238799
UniProt: A0A3Q7IT66
Position
9
AA seq 369 aa
MDLNNLFISLTPSWTSVSMLIGFFLYLATVGSILPGKLVPGATLSDGTRLHYRCNGLLSL
LLLVLLLGVGSQMNLVSPTAIADRGLELLSTTLIFSVLVTLMLYLVGLNSRAKSSSLKPH
VSGNLIHDWWFGIQLNPEFMGIDLKFFFVRAGMMGWLLINLSVLAKCVVEAKLSQSMILY
QLFCGLYILDYFFYEEFMTSTWDIIAERLGYMLVFGDLVFIPFTFSIQGWWLLSNKVELT
TAAIIANCLVFLIGYSVFRGANKQKHVFKKDPKAPIWGSPPKVIGGKLLASGYWGIARHC
NYLGDLLLASSFSLPCGISSVVPYFYPIYLLILLIWRERRDEARCAEKYKDVWAEYRKLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaataatctcttcatttctctcactccatcatggacttcggtgtctatgttg
atcggattttttctctatttagctaccgttggatctattctacccggaaaacttgttcct
ggggcgactttatctgatggaactcgactccattatcgttgcaatggtttattatcactt
ctgttgttggttttgcttcttggagttgggtcgcagatgaatcttgtttcacctactgct
atagcagatagaggacttgagcttttgtccacaacacttatctttagtgttcttgtgaca
ttgatgctttatttggttggcctgaactcacgtgcaaagagttcatcactgaaacctcat
gtctcaggaaatctaatccatgactggtggtttgggatacaactgaatcctgaattcatg
ggcattgatctcaaatttttctttgttagagctggtatgatgggatggttacttatcaat
ctttcagttcttgcaaaatgtgttgtagaggctaaattgagccaatcaatgattctctac
cagctattttgtgggctctacatccttgactacttcttctatgaagagttcatgacctcc
acatgggatataatagcagagaggttgggctacatgctggtttttggtgatctagtcttt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacaaagtggagctaaca
acagcagcaataattgccaattgcctcgtctttcttattgggtactcggtgttcagagga
gccaataagcagaagcatgtatttaaaaaggatcccaaggcacccatatggggtagtcct
ccaaaagttattgggggaaagttgcttgcttctggctattggggcattgcacggcactgt
aattacctcggggatttgttgctggcatcgtcttttagtttaccttgtggtataagctct
gtggttccatacttttaccccatatatcttctcattctactcatatggagggagagaagg
gacgaagctagatgtgcagagaagtacaaagatgtgtgggctgaataccgtaaacttgtt
ccttacaggatcttaccttacgtttactag

DBGET integrated database retrieval system