KEGG   Solanum lycopersicum (tomato): 101244287Help
Entry
101244287         CDS       T02665                                 

Definition
(RefSeq) erlin-2-B
  KO
K23341  erlin
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:sly04121]
    101244287
Ubiquitin system [BR:sly04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    101244287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 101244287
NCBI-ProteinID: XP_004239055
Position
5
AA seq 361 aa AA seqDB search
MDAQQQQRQQGVPARPRSGAGRDGGGDFTPILTVLVAFISIFALIVAPSISTLNNSVSIL
HQVPEGHVGVYWRGGALLNTITDPGFHLKLPFITQFEPIQVTLQTDLVRDIPCGTKGGVM
INFEKIEVVNRLRKDHVYDTLLNYGVNYDNTWIYDKIHHEINQFCSAHSLQQVYIDMFDQ
IDEKMKDALQADCTRYAPGIEILSVRITKPSIPESIRRNFENMEQERTKVLIAVERQRVA
EKEAETQKKIAISEAERNAHVSKIQMEQKLMEKDSARKQEEISNSMYLAREKSLADASYY
RTMKEAEANKLKLTPEFLELRFIEAIANNSKIFFGNKVPNMVLDQRLLGNFLQEPVPRAE
S
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgcagcaacagcagagacaacaaggtgttccagctcgcccaaggtccggcgcc
ggcagggatggcggcggagacttcactcctattctcactgtgctcgttgctttcatctcc
attttcgcattgattgtggctccttctatttcaacattaaataatagtgtatccatttta
caccaagtgccggaaggtcatgttggagtctattggagaggaggtgcccttttaaataca
ataactgatccaggttttcatttgaaactgccctttataactcagtttgaacccatacaa
gttactcttcaaacagatctggtgagggatattccttgcggaaccaaaggaggcgtgatg
atcaactttgagaaaatagaagttgttaaccgccttcggaaggaccacgtgtacgatact
ctgctgaattatggggtcaattatgataatacatggatatacgacaagatccaccatgag
atcaatcagttctgcagtgctcacagccttcaacaagtttatatcgacatgtttgatcag
atcgatgaaaaaatgaaagatgcacttcaggctgactgcacacgatacgctccaggtatt
gagattctcagtgtacgtattacaaaacccagcatcccagagagcataagacgaaatttt
gagaacatggaacaggagcgcaccaaggtcttgattgcagtagagagacaaagagttgct
gagaaggaagcagagacgcagaaaaagatagcaattagtgaagctgaaagaaatgctcat
gttagtaagatccaaatggaacagaagttgatggaaaaagacagtgctaggaaacaagag
gaaatttcaaactcaatgtatctagctcgtgaaaagagcctggcagatgcatcttactat
cgaactatgaaagaagcagaagcaaacaagctaaagcttactccagaatttctagaattg
cgattcattgaagctatagccaataactcgaaaattttctttggaaacaaggtgcccaac
atggttcttgaccaaaggctacttggaaactttttgcaagagcctgtacctcgagcggag
tcttag

DBGET integrated database retrieval system