KEGG   Solanum lycopersicum (tomato): 101245351Help
Entry
101245351         CDS       T02665                                 

Definition
(RefSeq) protein PHYLLO, chloroplastic isoform X1
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00130  Ubiquinone and other terpenoid-quinone biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    101245351
Enzymes [BR:sly01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     101245351
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     101245351
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     101245351
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     101245351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C Abhydrolase_6 TPP_enzyme_M_2 Abhydrolase_1 Hydrolase_4 TPP_enzyme_C Abhydrolase_2 Ndr BAAT_C DUF900 Abhydrolase_3 TPP_enzyme_M DLH
Motif
Other DBs
NCBI-GeneID: 101245351
NCBI-ProteinID: XP_004237229
Position
4
AA seq 1698 aa AA seqDB search
MNSHSLTGTYSFPFYPSLPIRRTIINVIDYNHFPLLTSRRFTLHRLCKKTNFQVVRCSRQ
ENRVLEPEDAALLISTCITRNLSPALTLEQGLEKIKEAVEELKAKPPCSSNGMFRFQVAV
PPSSKSLNWFCCQPESSGVFPQFFLSKEKQNPSYKSVEMGHTRGIFGIGAAINLKGFSAT
KESGEFGRCCAVESTPVVAYGFLDLSFDTISSFMKQEAGLFYFFVPQIELVEFEGASILS
AMVAWNDTCMCTFEEALQTYESSLLQAERNFSFEEDGRCSNHIGATDRKVHAQEGQVQMV
YSNLQKLFEKYVGPGAVKLKDASCYSSQFVVRLSPALAVSNNMPRQNDHTQFSCRLKDCA
NINILWASLIIEECTRLGLTYFCIAPGSRSSPLAIAASTHPTTSCIACIDERSLAYHAAG
FARSSHKPAVIITSSGTAVSNLHPAVVEASQEFVPLLLLTADRPPELQDVGANQAINQVN
HFGPFVRHFLSLPVPSDDISARMVLTSIDSAVNIATSSPSGPVHINCPFREPLENSPRTW
NPICLRGLDSWMSTSVPFTSYIRVQHSYRCNYNTFMDEALEVINKASRGFLLLGAIHRED
DIWAALLLAKHLSWPVVVDILSGLRLRKYFVPFPEFEDRILFIDHLDHMLLSDSIKDWMK
VDVIIQIGSRITSKRVAQLLESCFPCSYILVDNHPSRHDPSHIVTHRIQCAIPQFADYLI
TACTPHTRRKWECLLQALNSVAAWDISFLINSEYSLTEPCVAQMTLEAIHCESAVFLGNS
MPIRDADMYACNFNWKERTQDEVIFSSELTCHFIQVTANRGASGIDGLLSTAVGFAVGCN
KRVLCVVGDVSFLHDTNGLSLLRKQMLRKPMTIVVINNRGGAIFSLLPLANMTARSILDQ
YFYTSHNVSIHNLCMAHGVKHLKVQSKMELQDALLASQIDKEDFVIEVDSTIDANAAFHS
MLRKVSQQGVDHAFNSLSKLTVLNSMNDGFIPSKVGKMQYSSYRIQLSSPPTSSSESHRS
TYHREGFIISLCLEDGNTGYGEVAPLEIHQENLLDVEEQLQFLIHVVEGATIDHSLPLLK
GSFSRWLWQRLGIQPNSIFPSVRFGLEMAVLNAIAAREGSSLLNVLRVQTEESTDSSLDV
KVCALLESNGGPSEMALVATTLVREGFTAIKLKVARQADPTVDIAIIKEVRKKIGWEIEL
RADANRSWNYDEAVKFGLSVKDSGLQYIEEPVNNEDDIIKFCEETGLPVALDETINSIRK
NHLNVLVKYNHPMIVAFVIKPSVVGGFENAALLARWAHQHGKMAVISATFESSLGLSALI
QFSRYVDLMKLDTGRMLNKEENSCVAHGLGTYQWLREDVSRRPLMIGYNPCNGVVEASVT
DAAQILQHFQFNQDAVVPDCTSRELHAYEFVADLEGASICLNVQEIGKKDDSSVVVFLHG
FLGTGGDWISVMKSISGSARCIAVDLPGHGRSKLLGQDFDLEEPGLSIMAFAKILQQLFD
SLQCQKVVLVGYSMGARISLYMALRCNYKVAGAVIISGSPGLIDEEARKVRRAKDDFFAC
SFAASGLEPFLDAWYSGDLWNSLRAHPHFNEILASRLQHCDLKNLGRVLADLSVGRQPPL
WEDLKSCRVPLQLIVGEKDVKFKNIAQQMCDTMCQSTETTNIPEIVEIPYSGHAAHIENP
LTVISAISQFIREVEFNS
NT seq 5097 nt NT seq  +upstreamnt  +downstreamnt
atgaattctcacagcttaaccggaacttactcattccctttttatccatctctcccaatt
cgccgtacaatcatcaatgtcatcgactacaaccattttcccctacttacttcccggcgc
ttcacactgcatcgtctctgcaaaaaaacaaactttcaggtagttcgctgttcacgtcaa
gaaaacagagtattggaaccagaggatgcagcattgttgatttctacgtgtattactcgc
aatttgtctccggctttaactttagaacaaggattggaaaagattaaggaggccgtggag
gagctcaaggccaagcctccttgttcttctaatgggatgttcagattccaggttgctgtt
cctcccagttcaaaatctttgaattggttttgctgtcaaccggagtcatcaggagtattc
ccacagtttttcctttccaaggagaagcaaaatccatcatataaatcagttgaaatgggt
catacacgtgggatctttggaattggggcagcaatcaacttgaagggattttctgccact
aaagaatctggggaatttggaagatgttgtgctgttgaatcaacacccgtggtggcttat
ggctttttggacctaagttttgatacaatatcttctttcatgaagcaagaagctgggtta
ttctacttctttgttccccagattgaactagtggagtttgaaggtgcttctatcttatct
gcaatggtggcatggaatgacacttgtatgtgtacctttgaggaggctcttcaaacatat
gagtcatcacttttgcaggctgaacgtaacttcagttttgaagaagatggacgctgcagc
aatcacattggtgcgactgatagaaaagtccatgcacaggagggacaagtccaaatggta
tactcgaatcttcagaaactgttcgaaaaatatgttgggcctggtgctgtgaaactgaaa
gatgcctcatgctattccagccagtttgttgtgagactatcacctgctcttgcggtttcg
aataacatgcctcggcagaatgatcacactcaattcagttgccgcttgaaagattgcgca
aacatcaatatcttgtgggcatcacttataattgaggaatgcactcgacttggtctgacg
tatttttgtatagctccaggatcacggtcatctcctcttgctattgctgcttctactcat
cctactacaagttgtattgcatgcatcgatgaacgctcacttgcatatcatgccgctggt
tttgccagaagttctcacaaacccgctgtaatcatcacgtcatcaggcacagcagtttca
aatcttcatcctgctgtcgtggaagccagtcaagaatttgttcccctgctgttacttaca
gcagatcgacctccagagctgcaagatgttggagcaaaccaagccatcaatcaggtcaat
catttcggtccatttgtgaggcacttccttagtcttcctgtgcccagtgatgatatttct
gcaagaatggtgcttacctccattgactctgctgttaatattgcaacttcttcaccaagt
ggtccagttcatatcaactgtccttttcgagaaccactggaaaatagtccaagaacatgg
aaccctatttgtttaagagggttagactcttggatgtctaccagtgtaccttttaccagc
tatatccgagttcaacattcttatagatgcaattacaataccttcatggatgaagctctg
gaagtgataaataaggcaagtagaggctttctgttgcttggcgctatacaccgggaggat
gatatatgggctgctcttctccttgctaaacacctttcatggcccgttgtagttgacatt
ctgtcaggtctccgactgagaaaatattttgttccatttcctgaatttgaagatagaatt
cttttcatcgatcatctagatcatatgctactttcagactccatcaaggattggatgaag
gtggatgtgataatccagattggaagtcggataacaagcaagcgtgtggctcaactgcta
gagagctgttttccatgttcatatatattggttgacaatcatccaagtcgtcatgatcct
tcacatattgtaacacatagaatccagtgtgcaattcctcagtttgcagattatttgatc
acagcttgtacaccacatactaggagaaaatgggaatgtcttttacaagcattgaatagt
gtggctgcatgggatatctcatttctaatcaattctgagtactccttgactgagccttgc
gttgcacaaatgactctggaagctattcactgcgagtctgctgtatttttgggtaacagc
atgccaatacgtgatgcagacatgtatgcgtgtaactttaactggaaagaacgtacccag
gatgaagtcatattcagctcagagttaacttgccactttattcaggtcactgctaacaga
ggagctagtggtattgatggtctgcttagcacagctgttggtttcgcagttggatgcaac
aaaagagtactttgtgtagttggagatgtttcttttctgcatgatacaaatgggctgtcc
cttttgagaaagcagatgctgcggaagcccatgactatagttgttattaacaaccgtggt
ggcgccatattcagtctccttcctcttgcgaatatgactgccagaagcattttagaccag
tatttctacacatctcataatgtttcaattcacaacctatgcatggcacatggtgtgaag
catttgaaagtacagagcaaaatggaactacaagatgctctattagcatctcaaatagac
aaggaagattttgttatagaggttgatagcaccattgatgccaatgctgcctttcatagt
atgctgagaaaagtttcacagcaaggagtggatcatgctttcaacagcctttcgaaacta
actgttttgaattcgatgaatgatgggttcatacccagcaaagttggtaaaatgcagtac
tcaagctatagaattcagctgtcgtctcctcctacttcatcttctgaaagtcacagatcc
acctaccaccgagaaggcttcattataagtttgtgtcttgaagatggtaatactggatac
ggagaggttgcaccacttgagatccaccaggagaacctacttgatgtggaagagcagctt
caattccttattcatgttgtggaaggagctactattgaccactctcttcctttgctgaag
ggttcattttctcgttggctgtggcaaagattaggtatccagcccaattcaatcttccct
agtgtgagatttggtctagagatggctgtcctcaatgctattgcagctagagaaggttca
agcctgttgaatgtactccgcgtacaaacagaagaatcaactgatagttctttagatgtc
aaagtttgtgcactgcttgagtctaatggtggtcccagtgaaatggctcttgttgcaaca
acacttgtcagagaaggatttactgctataaagctaaaggtagcacgtcaagcagatccc
actgtggacattgcaattataaaggaggtaagaaagaaaattggttgggagattgagctg
cgtgctgatgcaaatcgaagttggaactatgatgaagctgttaaatttggcctttctgta
aaagatagtggcctgcagtatattgaggagcctgttaataatgaagatgacataatcaag
ttctgcgaggagactggcttaccagtagctcttgatgaaactatcaacagtataaggaaa
aatcaccttaacgtgcttgtaaagtacaatcacccaatgatagttgcttttgttatcaaa
ccaagcgtcgttggcggttttgaaaatgcagcattgcttgcgcgatgggctcaccagcac
ggaaagatggctgttatcagtgccacatttgaaagttccttgggtttatcagctctaatt
cagttctcacggtatgttgacctgatgaagttagatacaggaagaatgcttaacaaggaa
gagaactcttgcgtagcccacggtcttggaacttatcaatggcttagggaagatgttagc
agaaggcctttaatgattggctataatccttgcaacggtgttgtggaggcatctgttact
gacgctgctcaaatcctgcagcattttcagttcaaccaagatgcagttgttcctgattgt
acttccagagaacttcatgcatatgaatttgtggcagatcttgaaggtgcctccatctgt
cttaacgtgcaagaaattggaaaaaaggatgatagtagtgtagtagtatttcttcatggc
ttccttggaactggaggagattggatctctgttatgaagtctatatcaggctcagctaga
tgcattgcagtggacctacctggacatggaagatcaaagttgctcggccaggattttgat
ttggaggaaccagggttgtcaattatggcctttgcaaaaatattgcagcagttgtttgac
agtttacagtgtcaaaaagttgttcttgttggatattctatgggagcaaggatttctctc
tacatggctctaagatgcaattacaaggttgctggagctgttataatatctggaagtcca
ggattgatagatgaagaggcaagaaaagtacgtagagccaaggatgattttttcgcctgc
tcttttgctgcttctggcttagagccatttttagatgcttggtattctggagatctctgg
aatagtttaagagctcatccacatttcaatgaaatacttgctagccgattgcagcattgt
gatctgaaaaatcttgggagagtattagcagatctgagtgttgggagacagccgccatta
tgggaggatctgaagagctgcagagtaccgcttcagctcattgttggagagaaagatgtt
aaatttaagaacattgctcaacagatgtgtgacacaatgtgccagagcacagagactaca
aacattccagaaatagttgaaattccatattctggtcacgctgcacatatagagaatcct
ctcaccgttatcagtgcaataagtcagtttatcagagaagttgagttcaattcataa

DBGET integrated database retrieval system