KEGG   Solanum lycopersicum (tomato): 101247812Help
Entry
101247812         CDS       T02665                                 

Definition
(RefSeq) NAD(P)H-quinone oxidoreductase subunit M, chloroplastic
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif
Pfam: NdhM
Motif
Other DBs
NCBI-GeneID: 101247812
NCBI-ProteinID: XP_004237361
UniProt: K4BSZ1
Position
4
AA seq 211 aa AA seqDB search
MAATSTYMASTHFSMLSWSTKGKNKQLKRRNFFSVSAQQAEVEELKLKKEEEKKEEEKQE
EGAMKKPRPVEPQINVQSKNMTREHGGQWLSSATRHVRIYAAYIDPETFAFDQTQMDKLT
LLLDPTDEFVWTDDTCTKVYSYFQELVDHYEGAPLTEYTLRLIGSDIEHYIRKLLYNGEI
QYNMNARVLNFSMGKPRVGFNYNGQMEDVNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaacttcaacatacatggcttcaacccatttcagcatgttaagttggagcaca
aagggaaagaataaacaactcaaaaggagaaacttcttctcagtttcagcacagcaagca
gaagttgaagagttaaaactaaaaaaagaggaagaaaagaaagaagaagaaaaacaagaa
gagggggcaatgaagaagccaaggccagtagaaccacaaataaatgtgcagagcaagaac
atgaccagagaacatggaggacaatggctcagtagtgctactagacatgttcgaatatat
gcagcttatattgatcccgaaacctttgctttcgatcaaacacaaatggataaactcaca
ctccttcttgaccctactgatgaatttgtgtggactgatgatacttgtaccaaagtctat
tcttacttccaagaacttgttgatcattatgagggagctccattgacggagtacacgctt
cgcctgataggttcagacatagagcactacataagaaaacttctctataatggagaaatc
caatacaacatgaatgcaagagttcttaacttcagtatggggaaaccaagagttgggttc
aattacaatggacaaatggaagatgtaaaccagtaa

DBGET integrated database retrieval system