KEGG   Solanum lycopersicum (tomato): 101247918Help
Entry
101247918         CDS       T02665                                 

Definition
(RefSeq) aspartate--tRNA ligase 2, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:sly00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    101247918
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sly01007]
    101247918
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sly03016]
    101247918
Enzymes [BR:sly01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     101247918
Amino acid related enzymes [BR:sly01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   101247918
Transfer RNA biogenesis [BR:sly03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    101247918
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon tRNA-synt_2d
Motif
Other DBs
NCBI-GeneID: 101247918
NCBI-ProteinID: XP_004239653
UniProt: A0A3Q7GPU8
Position
5
AA seq 544 aa AA seqDB search
MESEKPQNPSPMEPQEEGSNKISKKEAAKLERQRRRQEAAAAAAATAVSTVSIEESDPLS
GNYGDVELNDLQSKAVTGRKWTEVGSIAPEMKDRVVLVRGRVQTIRPVGKKIAFVVVRER
GFTVQCVLTVKPELVSSQMVKYATSLSKESIIDVEGVVTIPEKPITGATQQQVEVQISKL
YCVNRAVPTLPINIEDAARSEVEIEQALEKGEQLVRVNQDTRLNFRILDMRTPANQGIFR
IQCQIENIFRQFLLSEGFVGIHTPKLIGGSSEGGSAVFRLDYKGQPACLAQSPQLHKQMA
ICGDFGRVFEVGPVFRAEDSFTHRHLCEFTGLDVEMEIKEHYSEVMDIVDRLFVAMFDSL
NEKCKKELEAVGKQYPFEPLKYLRKTLRLTFAEGIQMLKEAGVEVDPLGDLNTESERKLG
QLVAEKYGTEFYILHKYPQAVRPFYTMPCHDNPSYSNSFDVFIRGEEIISGAQRVHVPEL
LEKRAGECGIDVKTISTYIDSFRYGAPPHGGFGVGLERVVMLFCALNNIRKTSLFPRDPQ
RIVP
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggagaaaccccaaaatccatctccaatggaaccacaagaagaaggcagcaac
aaaatctccaaaaaagaagccgccaagctggagcgtcagcgccgccgtcaagaggcagcc
gccgccgccgccgccactgctgtctccactgtctccattgaagaatctgatccactttcc
ggaaactacggtgacgtagagctgaacgatctgcaatctaaggccgtgacgggtcgaaag
tggactgaagttgggtccatcgcgccagaaatgaaggaccgggtggtcttggttcggggg
agggtacagacgattcgtcctgttgggaaaaagatagcttttgtggttgtgagggaacga
ggatttacggtgcagtgtgtattgactgtgaagcctgaattggttagttcacaaatggtg
aaatatgctactagtttgagcaaagagtccattattgatgttgaaggtgttgttacaata
ccagagaagccaattactggtgccactcaacaacaggtggaagttcaaataagcaaactt
tattgtgtcaacagggctgtgcccactctaccgattaatattgaggatgctgctagaagc
gaggtggagatagaacaagctttagagaaaggagagcagcttgttcgtgtaaatcaggat
actcgcttaaacttcagaatactagacatgcgcacacctgcaaatcaaggaatcttccgc
attcaatgtcaaatcgaaaatatattcaggcagtttttgctctctgaaggatttgtagga
atccatactccaaaattgattggagggtctagtgaaggaggttcagctgttttccgatta
gattataaaggtcaacctgcatgtctggcgcagtcacctcaacttcacaaacaaatggca
atatgtggtgattttggccgtgtatttgaagtaggccccgtctttagggcagaagattct
tttacacatagacatctgtgcgagtttacaggtcttgatgttgaaatggagatcaaggaa
cattattcagaggtcatggatattgttgaccgcttatttgtggccatgtttgatagcttg
aatgagaaatgcaaaaaggaacttgaagccgttggaaagcaatacccttttgaacctctg
aagtatttgcgaaagaccttacgacttacatttgctgaggggattcaaatgctaaaggaa
gctggtgttgaagttgatcctcttggggacctaaatacagaatcagaaagaaagcttggg
cagcttgttgcggagaagtatggaactgaattctatatacttcacaagtacccacaggct
gttcgtccattctataccatgccttgtcatgacaatccatcttacagcaattcttttgat
gtctttatcagaggggaggaaattatctcaggagctcagcgtgtccatgttcctgaactc
ttggaaaaacgtgccggagaatgtggaattgatgtgaagacaatatcaacatacattgat
tctttccggtatggtgcacctccccatggtggatttggagtcggattggagcgtgtggtg
atgcttttctgtgctctcaataacattcgcaagacatcacttttccctcgcgacccacaa
aggattgtcccatga

DBGET integrated database retrieval system