KEGG   Solanum lycopersicum (tomato): 101248057Help
Entry
101248057         CDS       T02665                                 

Definition
(RefSeq) acyl-coenzyme A oxidase 4, peroxisomal
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00071  Fatty acid degradation
sly00592  alpha-Linolenic acid metabolism
sly01040  Biosynthesis of unsaturated fatty acids
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01212  Fatty acid metabolism
sly04146  Peroxisome
Module
sly_M00087  beta-Oxidation
sly_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101248057
   00592 alpha-Linolenic acid metabolism
    101248057
   01040 Biosynthesis of unsaturated fatty acids
    101248057
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101248057
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     101248057
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_M Acyl-CoA_dh_N Acyl-CoA_dh_2
Motif
Other DBs
NCBI-GeneID: 101248057
NCBI-ProteinID: XP_004249072
Position
10
AA seq 439 aa AA seqDB search
MKVPPTKTQEEMYKEAKSSYFDLPALDVSVAFPQATPASVFPNCTSDYYQLDDLLTSEEK
AVRLKVRECMEKEIAPIMTKYWEKAEFPFEVIPKLGALNISGGTIKGYGCPGLSVTGSAI
ALAEIARVDASCCTFILVHSSLAMLTIGLLGSEMQRQKYLPSLADLSSISCWGLTEPDYG
SDASALRTTATKVEGGWILEGQKRWIGNSTFADVLVIFARNAATNQINGFIVQKDAPGLQ
CTKIENKIGLRMVQNGDILFKKVFVPDEDRLPGVNSFNDTSKVLAVSRVMVAWLPIGIAM
GVYDMCHRYLKERKQFGAPLAAFQLNQQKLVQMLSNIQAMLLVGWRLCKLYESGKMTPGQ
ASLGKSWNTLRARETVSLGRELLGGNGILTDFLVAKAFCDLEPIYTFEGTYDINTLVTGR
EITGLPSFKPAPLRPQSRL
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttccaccaactaaaactcaagaagaaatgtataaagaggcgaaaagttcctat
tttgatctaccagctttggatgtttctgttgcatttcctcaagcaacaccagcgtccgtc
tttcctaattgcacttcggactattatcagcttgatgatctcttgacttctgaagagaaa
gccgtcagactgaaagtgagagagtgcatggaaaaagaaattgctcctataatgacaaag
tactgggaaaaagcagagtttccgtttgaagttattccgaaacttggtgctttgaacata
tctggtggcactataaaggggtatggttgtccaggtttatcagtaactggaagtgccatt
gctctagcagaaattgccagagtagatgcaagctgctgtacattcattttggtgcattca
tctttggcaatgctcactattggactattgggatcagaaatgcaaaggcaaaaatactta
ccatctctggctgatcttagcagtatatcttgttggggtctaactgagccagactatgga
agcgatgcaagtgctttgaggaccactgccacaaaggttgaaggaggttggatccttgaa
gggcaaaaacggtggataggaaacagcacttttgcagatgtgttggttatatttgccaga
aacgcagccacaaaccaaataaatggtttcattgtacagaaggatgctccaggcttgcaa
tgtactaaaatagaaaacaaaattgggttgcggatggttcagaatggagatatcctcttt
aagaaagtgtttgttcctgatgaggatagactaccaggtgtcaattctttcaacgataca
agtaaggtgcttgctgtatcacgtgtcatggttgcatggctgcctataggcattgcaatg
ggtgtatatgatatgtgtcacaggtatttaaaagagaggaaacagttcggagctccattg
gctgctttccagttaaatcaacagaagcttgttcagatgttgagcaacattcaggctatg
cttcttgttggatggcgtctttgcaagttgtatgagagtggtaaaatgactcccggtcag
gctagcttggggaagtcatggaataccttgagggctagagagaccgtttctcttggacgg
gaattacttggtggtaacggtatcttgaccgacttcttagtggcaaaggcattctgtgac
ttggagcccatctatacgttcgagggtacctatgatatcaacactctagtaacaggtaga
gaaattacaggtcttcctagcttcaagccagcaccattgaggccacagagtcgtctgtaa

DBGET integrated database retrieval system