KEGG   Solanum lycopersicum (tomato): 101248445Help
Entry
101248445         CDS       T02665                                 

Definition
(RefSeq) isocitrate dehydrogenase [NADP] isoform X1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00020  Citrate cycle (TCA cycle)
sly00480  Glutathione metabolism
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
sly01210  2-Oxocarboxylic acid metabolism
sly01230  Biosynthesis of amino acids
sly04146  Peroxisome
Module
sly_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101248445
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101248445
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101248445
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     101248445
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 101248445
NCBI-ProteinID: XP_004250238
Position
11
AA seq 415 aa AA seqDB search
MAFQKIKVANPIVEMDGDEMTRVIWKLIKDKLILPFLELDIKYFDLGLPHRDATDDKVTI
ESAEATLKYNVAIKCATITPDEARMNEFNLKHMWKSPNGTIRNILNGTVFREPILCKNIP
RLVPSWSKPICIGRHAFGDQYRATDTVIQGAGKLKLVFVPEGTDEKTEFEVYNFTGAGGV
ALSMYNTDESICSFAEASMNMAYQKKWPLYLSTKNTILKKYDGRFKDIFQEVYESKWKSK
FEEAGIWYEHRLIDDMVAYALKSDGGYVWACKNYDGDVQSDFLAQGFGSLGLMTSILICP
DGKTVEAEAAHGTVTRHYRVHQKGGETSTNSIASIFAWTRGLAHRAKLDNNTALLDFTKK
LEAACIGAVENGKMTKDLALIIHGSKVARRQYVNTGEFIDAVADELKARLLKAKI
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctttccaaaagatcaaagtggctaaccccatagttgaaatggacggagatgaaatg
acccgtgtcatttggaaattaattaaggataagctcatcttgccttttctggagttggat
ataaaatacttcgatcttggacttcctcatcgtgatgccacagatgataaggttacaatt
gaaagcgctgaggctactttgaagtataatgtagctattaagtgtgcaaccattactcca
gatgaggctcgtatgaacgagtttaacttgaagcatatgtggaagagcccaaatgggaca
attaggaacattttgaatggtacggtgttcagggaaccaatcctctgcaaaaatatcccg
cgacttgttccaagttggtcaaaaccgatatgcattggcagacatgcttttggtgatcaa
taccgagctactgatacagtgattcaaggagctggaaaactcaaattagtatttgtacca
gaagggacagatgaaaagaccgagtttgaggtgtacaacttcactggtgctggtggagta
gctctatccatgtacaacactgatgagtctatttgctcttttgctgaagcttctatgaac
atggcataccaaaagaaatggccactctatcttagcacaaaaaataccatccttaagaaa
tacgacggaagattcaaggacatattccaggaagtttacgagtcaaaatggaagtcaaag
tttgaggaagctgggatctggtacgaacatcgcctcattgatgatatggttgcttatgct
ttaaaaagtgacggtggttatgtatgggcatgtaaaaactatgatggagatgtacagagt
gatttcttagcacaaggatttggatcgcttggattgatgacatcgatcctgatatgtccg
gatggaaagaccgtggaagcagaagcagcccatggaactgttacacgccactacagggtt
catcagaaaggaggtgaaaccagcacaaatagcattgcctcgatttttgcttggactcgt
ggacttgcacatagggcaaagttggacaacaatactgcactcttggatttcaccaagaaa
ctagaagcagcttgcattggtgcagtggagaacgggaaaatgacaaaagatctagcactt
attatccacggatccaaggtcgctagacgtcaatatgtgaacactggagagttcatcgat
gctgtggctgatgagctgaaagctagacttctaaaagcaaagatataa

DBGET integrated database retrieval system