KEGG   Solanum lycopersicum (tomato): 101249957Help
Entry
101249957         CDS       T02665                                 

Definition
(RefSeq) UDP-glucuronic acid decarboxylase 1
  KO
K08678  UDP-glucuronate decarboxylase [EC:4.1.1.35]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00520  Amino sugar and nucleotide sugar metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    101249957
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.35  UDP-glucuronate decarboxylase
     101249957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD NAD_binding_4 RmlD_sub_bind Polysacc_synt_2 adh_short
Motif
Other DBs
NCBI-GeneID: 101249957
NCBI-ProteinID: XP_010326162
Position
9
AA seq 385 aa AA seqDB search
MKLYKQSSRRDEDLPNSQPYSPKTLKYPRGSLPRSINYLLKEQRLLFILVGILIGSTFFI
IQPSLSHLSTSSEPHSSIPRSYNALNHESLSKLASYNDKDVSFRVNGVTGRVPVGVGRKR
MRIVVTGGAGFVGSHLVDKLIKRGDDVIVIDNFFTGRKENVKHHFGNPRFELIRHDVVEP
ILLEVDQIYHLACPASPVHYKYNPVKTIKTNVMGTLNMLGLAKRIGAKFLLTSTSEVYGD
PLEHPQKETYWGHVNPIGVRSCYDEGKRTAETLTMDYHRGANVEVRIARIFNTYGPRMCL
DDGRVVSNFVAQAIRKQPMTVYGDGKQTRSFQFVSDLVDGLVALMDGEHIGPFNLGNPGE
FTMLELAGVVKEVIDPSATIEFKAN
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgtacaaacagtcaagtagaagagatgaggatttacccaattctcaaccatac
tcaccaaagaccttgaaatacccaagaggatctcttcccagatccatcaattatctcctc
aaagaacaaagacttctgttcattcttgttggtattctaattggttcaacttttttcatc
attcaacctagtctatctcatcttagcacatcttctgaaccacattcttcaatacccaga
tcatataatgctttaaatcatgaatctttatcaaaattagcttcatataatgataaagat
gtaagctttagggtgaatggggttactgggagggttccagttggggttgggaggaaaagg
atgaggattgtggtgactggtggtgctggatttgtggggagtcatttagtggataagttg
attaagagaggtgatgatgttattgtgattgataatttctttacgggtaggaaagaaaat
gtgaaacatcattttgggaatccaagatttgagcttattaggcatgatgttgttgagcct
atcttgttagaagtagatcagatttaccatttggcttgtcctgcttctccagttcactac
aagtataatcctgtcaaaactattaagacaaatgtgatgggcacccttaacatgttgggg
cttgccaagagaattggtgctaagttcttgcttaccagtacaagtgaggtttatggtgat
ccgcttgagcatcctcaaaaggaaacatattggggtcatgtgaatccaataggtgttagg
agctgctatgacgagggaaaacggactgcggaaaccttgactatggattaccatcgcggt
gcaaatgtcgaggttcgtattgctcggattttcaatacatacggacctcgtatgtgttta
gatgatggacgtgttgtcagcaactttgttgcgcaggccatccgcaagcaaccaatgaca
gtatatggggatggaaagcaaactcgaagttttcaattcgtctctgatctggttgatgga
ttagtggccctcatggatggtgagcacattggccctttcaacttgggaaatccaggagaa
tttaccatgttggagcttgctggggtggtgaaagaagtgattgatcccagtgccactatt
gagttcaaagccaac

DBGET integrated database retrieval system