KEGG   Solanum lycopersicum (tomato): 101251901Help
Entry
101251901         CDS       T02665                                 

Definition
(RefSeq) tryptophan decarboxylase TDC1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00350  Tyrosine metabolism
sly00360  Phenylalanine metabolism
sly00380  Tryptophan metabolism
sly00950  Isoquinoline alkaloid biosynthesis
sly00965  Betalain biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101251901
   00360 Phenylalanine metabolism
    101251901
   00380 Tryptophan metabolism
    101251901
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    101251901
   00950 Isoquinoline alkaloid biosynthesis
    101251901
   00965 Betalain biosynthesis
    101251901
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sly04147]
    101251901
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101251901
    4.1.1.105  L-tryptophan decarboxylase
     101251901
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101251901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC SepSecS
Motif
Other DBs
NCBI-GeneID: 101251901
NCBI-ProteinID: XP_004243301
UniProt: A0A3Q7HFV4
Position
7
AA seq 504 aa AA seqDB search
MGSLDSNNSSPTQTNVPKFNPLDPEEFRTQAHQMVDFIADYYKNIETYPVLSQVEPGYLR
TQLPENAPYCPEPFEAIMKDVHNHIVPGMTHWLSPNFFAFFPATVSSAAFIGEMLCNCFN
SVGFNWLASPAMTELEMIVMDWLANMLKLPKAFMFSGTGGGVLQSTTSEAILCTLIAARD
RKLDNIGVDNIGKLVVYGSDQTHSTYTKACKVAGILPCNIRAVPTCIESDFALSPAVLRG
IIEADVAARLVPLFLCATVGTTSTTAVDPLSQLGQLAEEFDIWLHVDAAYGGSACICPEF
RRYLDGIERANSLSLSPHKWLLSYLDCCCMWVREPNVLVKALSTNPEYLRNKRSEYDSVV
DYKDWQIGTGRKFKSLRLWLVMRSYGVANLQSHIRSDVRMAKMFEGFIRSDSRFEVVVPR
RFSLVCFRFNPNKEHEPVYIEFLNKKLLDSVNSTGLVYMTHTIVGGIYMLRFAVGATLTE
DRHVISAWKLIKESAEGLLRKSVF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgggaagccttgattccaataacagctctccaacccaaaccaacgttccaaaattcaac
ccgcttgacccggaagaattccggacccaagcccatcaaatggtggacttcattgctgat
tactacaagaatattgagacctacccggttctaagccaagtcgaaccgggttatctccgt
actcaattacccgaaaatgccccctactgccccgaaccattcgaggcaattatgaaagat
gtccacaaccatattgtccccggtatgacccattggttgagcccgaatttcttcgcattt
tttccagctactgttagttccgcagcgttcattggtgaaatgctttgcaattgtttcaac
tccgtcgggtttaactggctggcttcgccggccatgacggagttggaaatgatagtcatg
gactggctcgctaatatgttgaaattaccaaaagccttcatgttttctggcacgggtggt
ggtgtacttcaaagtacaaccagtgaagcgatcctatgcacgttaattgctgcacgtgat
cgtaaactcgataacataggcgttgataacatcggaaagcttgtagtctatggttctgat
caaacgcattctacgtataccaaagcctgcaaggtagctggtattttaccatgcaatatt
cgtgcggtgccaacttgtattgaaagcgatttcgctttatctcccgcagttctacgtgga
attattgaagctgatgttgctgctagacttgtcccgcttttcctctgtgctactgttggg
accacttccactacagccgtcgatcctctcagccagctgggtcagctggctgaggaattc
gacatttggcttcacgtggatgctgcttatggagggagcgcatgtatatgtccagagttt
agacgatacctcgatggaattgaacgagctaactcattgagcctaagccctcataagtgg
ctactaagttacttagattgttgttgcatgtgggtgagagaaccaaacgtgttagtcaag
gcattgagcacgaatcctgagtacctacgaaataaacgatccgaatacgactcggttgtg
gattacaaggactggcaaatcggtacgggacgaaagttcaagtctctccgattatggctc
gtcatgcgtagttatggcgtagccaatcttcagagtcacatcaggtccgatgttcgtatg
gccaaaatgtttgaagggttcattaggtctgattcgaggtttgaagttgtcgtgccacga
cgtttttcactcgtctgcttccggttcaaccctaataaggaacatgaaccggtgtatatc
gagtttttaaacaagaaattacttgatagtgttaattcaacgggtctagtttacatgact
cacacaatagttggtggaatatacatgttaaggtttgcagtaggtgctactctcacggag
gacagacatgtaatttcagcttggaagttgattaaggagtcggcagaaggtttgctgaga
aaaagtgtgttttaa

DBGET integrated database retrieval system