KEGG   Solanum lycopersicum (tomato): 101253022Help
Entry
101253022         CDS       T02665                                 

Definition
(RefSeq) polyamine oxidase 1
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00330  Arginine and proline metabolism
sly00410  beta-Alanine metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    101253022
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101253022
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     101253022
    1.5.3.16  spermine oxidase
     101253022
    1.5.3.-  
     101253022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_binding_3 Thi4 Pyr_redox_2 Pyr_redox_3 FAD_binding_2 HI0933_like Pyr_redox FMO-like Shikimate_DH GIDA AlaDh_PNT_C FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 101253022
NCBI-ProteinID: XP_004229651
UniProt: A0A3Q7EIR4
Position
1
AA seq 497 aa AA seqDB search
METPRRSSVIIVGAGISGLTAAKVLSENGVDDVVILEAADKIGGRIRKEEFGGVAAELGA
GWIAGVGGKQSNPVWELALQSNLRTCFSDYSNARYNIYDHSGKIFPSGIAADSYKKAVDS
AIQKLRSQEGNHNEDTDDAAETPSTPKTPIELAIDFILHDFEMAEVEPISTYVDFGEREF
LVADERGYEHLLYKMAENFLFTCEGKIMDSRLKLNTVVREVQHSRNGVLVTTEDGSLYEA
NYVILSVSIGVLQSDLISFSPSLPRWKMEAVRNLDVMVYTKIFLKFPNKFWPCEPEKEFF
IYAHERRGYYTFWQHMENAYPGSNMLVVTLTNGESKRVEAQSDQDTLREAMEVLRNMFGP
DIPDATDILVPRWWNNRFQRGSYSNYPIYANHQLVHDIKEPVGRIFFTGEHTSEKFSGYV
HGGYLSGIDTSNALLEKMRRDDGRKNESQAFLLEPLLALTGSLTLTQAETVSSLHKCDIP
RQLFLSNSKLGLPEAIL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggaaactccccgtcggtcctctgtgatcatcgtcggagccggaatctcaggattaacg
gcggcgaaggtgttatcggagaatggagtggatgatgtggtgatattggaggcggctgat
aagataggcggtaggataaggaaagaggaattcggcggagtagcggcggaactcggtgcc
ggttggatcgccggtgtcggcggtaaacaatctaatcctgtatgggaacttgctcttcag
tctaatctccgaacatgcttctccgattacagtaatgctcgttacaatatctacgatcac
agtgggaagatttttccgagtggaatagcggcggactcgtataagaaagcggtggactca
gcaattcagaaactcagaagccaagaaggaaatcacaatgaagacaccgacgatgcagct
gaaacgccgtcaactccaaaaacaccaatagagctggcgattgatttcattcttcatgat
tttgaaatggcagaagttgagccaatatcaacctatgtagattttggtgaaagagaattt
ctggttgctgatgaaagaggatatgaacatttgctttataaaatggcagaaaattttctt
ttcacctgtgagggtaaaattatggacagtcgactcaagctcaatacggttgttcgggaa
gtgcagcactcgagaaacggcgtcttggtgacaacagaagatggttccctttacgaagcc
aattatgtcattttgtctgttagcattggcgttctccaaagcgacctcatttcattctca
ccctctttaccgagatggaagatggaagccgtcagaaacttggacgtgatggtttataca
aagatctttctcaagttccctaacaagttctggccttgtgaacctgaaaaggagttcttc
atctatgctcacgagcgaagaggctactatacgttctggcagcacatggaaaatgcttat
ccgggatccaatatgctggtggtaaccctgacaaatggtgagtcaaaacgtgtggaagct
caatctgatcaagacacattaagagaagcaatggaagtgttaagaaacatgtttgggccc
gacattcctgatgccaccgacatattagtcccacgttggtggaataaccggttccagcgt
ggtagctacagtaattaccccatatatgcaaatcatcaactcgtccatgatattaaggaa
ccagtggggcggatatttttcacaggagaacacacaagtgaaaaatttagtggctatgtc
catggaggttacctttcaggtatagacactagcaacgctttacttgagaaaatgcgaagg
gatgatggaaggaagaatgagagtcaagcgtttctgttagaaccattgctagcattaaca
ggctctttgacactgacacaagctgagactgtatcaagtctccacaaatgtgatattccg
cgacaactcttccttagtaacagcaaattgggacttccagaggctatcttatga

DBGET integrated database retrieval system