KEGG   Solanum lycopersicum (tomato): 101253137Help
Entry
101253137         CDS       T02665                                 

Definition
(RefSeq) uncharacterized protein LOC101253137
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00030  Pentose phosphate pathway
sly00051  Fructose and mannose metabolism
sly00710  Carbon fixation in photosynthetic organisms
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
Module
sly_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
sly_M00165  Reductive pentose phosphate cycle (Calvin cycle)
sly_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
sly_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101253137
   00030 Pentose phosphate pathway
    101253137
   00051 Fructose and mannose metabolism
    101253137
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    101253137
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sly04147]
    101253137
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     101253137
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101253137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase Inositol_P CbeA_antitoxin
Motif
Other DBs
NCBI-GeneID: 101253137
NCBI-ProteinID: XP_004230574
UniProt: A0A3Q7ERH5
Position
1
AA seq 407 aa AA seqDB search
MLSSTISSLNFPPRTKLSSPNPAIFPQNYNFVPFCTENMASSPFSGGLINSRVDSPIAIG
CKNASVDSANSGFSTLMEYMGKGGVDVGDDLVLLFGHLEYASKKIAALVACPFNSSLNNN
VAIGNTGTSSDRDKPKPLDIVSNEIILSSLRNSGKVAVMASEEDECPVWITDDGPFVVVM
DPLDGSRNIDASIPTGTIFGIYRRLVEIDHLPVEEKALLNCLQSGSKLVAAAYVLYSSAT
ILCASFGSGTHAFTLDHTTGDFLLTHPNINIPPRGQIYSVNDARYFDWPEGLRQYIDTIR
QGKGQHPKKYSARYICSLVADFHRTLLYGGVAMNPRNHLRLVYEANPLSFLAEKAGGRGS
DGKNRILSIQPVKLHQRLPLFLGSLEDIEELQSYGDVQQKVNPGYDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctatcatcgaccatttcttccctaaattttccaccaagaaccaaactctcctcacca
aaccctgcaatttttcctcaaaactacaattttgtacctttttgtactgaaaatatggct
tcttctccattttctggagggttaattaactccagggttgattcaccaattgcaattggc
tgtaaaaatgcttcagtagattctgctaatagtgggttttcaacactgatggagtatatg
ggtaaaggaggggttgatgtgggtgatgacttggtgttattgtttggtcacttagaatat
gcctccaagaaaattgctgctcttgttgcttgccctttcaattccagcctcaacaacaat
gttgccattggaaatacggggacttcttctgatagagataagcccaagcctcttgatatt
gtttcgaatgagattatattgtcgtctcttagaaattcgggaaaagttgctgtaatggcc
tcagaagaagatgagtgtcctgtgtggataactgatgatggcccgtttgtggttgtcatg
gatcctttagatggttcccgaaatatagatgcctcaatacccactgggacgatatttggg
atttacagacgtcttgtggaaattgatcatttgccggtggaggaaaaggctttactaaac
tgccttcagagtggatcaaagcttgttgcagcagcttatgttctctattcgtcagccaca
atactctgtgctagctttggttctggaacacatgcattcacattggatcatacaaccgga
gatttcctcttgacacatcctaacatcaacattcctcctcgagggcaaatttattcagtt
aatgatgctcggtattttgactggcctgaaggattaaggcagtatattgatacgataaga
caagggaaaggacaacatcctaagaagtactcagccaggtatatatgttctctagtggct
gattttcatcggactctgttatatggtggcgtagcaatgaatccaagaaaccaccttcga
cttgtttatgaagcaaatcctctgagtttcttagcggaaaaggctggaggtagaggttca
gatggtaaaaatagaattttatctattcaacctgtcaagctacaccaaagacttcctcta
tttttgggaagtttggaggatatagaagaattacagagttatggagatgttcagcagaaa
gtgaaccctggttatgatgtttaa

DBGET integrated database retrieval system