KEGG   Solanum lycopersicum (tomato): 101253273Help
Entry
101253273         CDS       T02665                                 

Definition
(RefSeq) autophagy-related protein 16
  KO
K17890  autophagy-related protein 16-1
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:sly00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    101253273
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sly04131]
    101253273
   03029 Mitochondrial biogenesis [BR:sly03029]
    101253273
Membrane trafficking [BR:sly04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    101253273
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    101253273
Mitochondrial biogenesis [BR:sly03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    101253273
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 eIF2A Cytochrom_D1 FPP DUF5046
Motif
Other DBs
NCBI-GeneID: 101253273
NCBI-ProteinID: XP_004236299
Position
3
AA seq 509 aa AA seqDB search
MAYEEVAIEAIKHALKALRKRHLVEEGAHAPALAALNRPFVLQGSEWKEKAENLEVELQQ
CYKAQARLSEQLVVEVAESRASKSLLQEKETLITDLQNELNQARDECSHLTELLAEKTKG
LELLMAEHQDLKAQLEAMTLRANNAEAENKTLVDRWMLLKMQDAERLNEANALYGDMLDK
VKAASIEKLARQQVDGVVRQSEDGAEFYVESSIPSTCKQRIPAHDGGCASIVFEYNSSKL
ISGGQDRAIKMWDTTSGSLTNSLYGCLGSVLDLSVTHDNKFIIAASSSNNLYVWDANSGR
IRHTLTGHMDKVCAVDVSKFSSRHVVSAAYDRTIKVWDLQKGYCNNTIIFHSNCNSLAFS
MDALTICSGHVDGNLRLWDVQTGKLLSEVAAHSQAVTSVSLSRNGNMILTSGRDNLHNLF
DIRTLEICGTFRSNANRVASNWSRSCISADDGYVTAGSVDGSVHIWSVSNGKMVSTLKEH
TSSVLCCSWSGLGNPLATSDKSGTVCIWS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcatacgaagaagttgctatagaagccatcaagcatgctttaaaggccctaagaaag
cgtcatttagtagaagaaggggcccatgcccctgctttggctgcactcaataggcctttc
gttttgcagggttcagagtggaaagagaaagctgaaaatcttgaagtggaacttcaacaa
tgctacaaagctcaagcacgactgtcagagcagcttgtggtggaagtagctgaatccaga
gcatcaaaatctttacttcaggagaaagaaactctcattactgaccttcaaaatgagcta
aatcaagcaagggatgaatgttcacatttaactgaacttcttgcggaaaagactaaaggt
ttggaattgcttatggctgagcaccaggaccttaaagcacaacttgaagcaatgactctg
agagcaaacaatgctgaggcagaaaataaaacgttggttgaccgatggatgctgctgaag
atgcaggatgctgagcgccttaacgaggctaatgctctctatggagacatgcttgataag
gtcaaggccgccagtatagaaaaacttgctcgtcaacaagtggacggcgtggtccgccaa
agtgaagatggtgcagaattttacgtagaatcttccatccctagtacatgcaagcaaagg
atccccgcccatgatggtggttgtgcctcgattgtttttgagtataactcaagtaaattg
ataagcggaggtcaggatcgagcaattaaaatgtgggataccacaagcggatcattaacc
aacagtctttatggttgtctgggttctgttcttgatctttccgttacacatgataacaaa
ttcatcatagcagcaagtagttcaaataatttgtatgtgtgggatgcaaattcaggcagg
atacggcacactcttactgggcacatggacaaggtttgtgcagttgatgtaagcaaattt
tcaagtcgccatgtggtgagtgctgcatatgatcgcacaataaaagtttgggatctgcag
aagggttactgtaacaacactatcatatttcacagtaactgtaacagtcttgcgtttagc
atggatgccctgactatctgttctggtcatgttgatggtaatcttagattatgggatgtt
caaacaggcaagcttctgagtgaagttgctgcacattcacaggctgttacatcagtttca
ctctctcggaatggaaacatgatattaaccagtgggagagacaacttgcacaatctattc
gatatacgcacccttgaaatttgtggcactttcagatcaaatgcaaatcgagttgcatct
aattggagccgatcctgtattagtgccgatgacggttatgttactgcaggttctgttgat
ggatctgttcatatttggtcagtatcaaacggtaaaatggtaagcacattgaaagaacac
acatcctctgtactttgttgttcatggagtggtcttggtaatcctttggccacctcagat
aagagtggaaccgtatgtatttggtcatga

DBGET integrated database retrieval system