KEGG   Solanum lycopersicum (tomato): 101253756
Entry
101253756         CDS       T02665                                 

Gene name
LAT56
Definition
(RefSeq) probable pectate lyase P56 precursor
  KO
K01728  pectate lyase [EC:4.2.2.2]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00040  Pentose and glucuronate interconversions
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101253756 (LAT56)
Enzymes [BR:sly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.2  pectate lyase
     101253756 (LAT56)
SSDB
Motif
Pfam: Pectate_lyase_4 Beta_helix Herpes_BMRF2
Other DBs
NCBI-GeneID: 101253756
NCBI-ProteinID: NP_001296315
UniProt: P15721
Position
3
AA seq 398 aa
MEYSYRTKINVLFIVLILFVFAALGTAINAPRRKLTKKYRGPCMAVNSIDKCWRCDPFWA
EDRQKMADCALGFGINAMGGKYGPYYIVTDNSDDDVVDPKPGTLRFGVIQKGPLWITFAR
SMRIRLTRELIVSSNKTIDGRGKYVHIANGAGIKIQSASNVIISNLRIHNIVPTAGGLLR
ESDDHLGLRGADEGDAISIFNSHDIWIDHISMSRATDGLIDAVAGSTNITISNCHFTDHE
KVMLFGANDHAEEDRGMKITLAYNHFGKRLDQRMPRCRFGFFHLVNNDYTHWERYAIGGS
SGATIISQGNRFIAEDKLLVKEVTYREKSTSSVEEWMKWTWITDGDDFENGATFTPSGDQ
NLLSKIDHLNLIQPEPSSKVGLLTKFSGALSCKIRRPC
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggagtattcttatagaacaaaaattaatgtattattcattgtactcattctctttgta
tttgctgcactcgggacagcaataaacgctccgaggaggaaactaactaagaaatacaga
ggcccgtgtatggccgtgaattcaattgacaagtgctggagatgtgaccctttctgggct
gaagatcgccaaaaaatggctgattgtgcgttgggctttggtatcaatgcaatgggagga
aagtatggtccatactacattgtcacagataattctgatgatgacgttgttgatcctaag
cctggaactctccgattcggggtgatccaaaaaggaccattgtggatcacatttgccaga
agtatgagaatccgattgaccagggaacttattgttagtagcaataaaacaattgatgga
cgtggaaaatacgttcacatagcaaatggagctggaattaagatacaaagcgcatctaat
gttattatctctaatcttcgaattcacaatattgtacctaccgcaggtggcctgctaagg
gagtctgacgaccaccttggcctaaggggcgcagatgaaggtgatgccatcagtatcttc
aattctcatgatatatggattgaccacatctctatgtctcgtgccactgatggtctgata
gatgctgttgctggttccactaatattacgatatccaactgtcacttcactgatcatgaa
aaggtaatgttgtttggtgctaacgatcatgcggaagaggacaggggaatgaaaataaca
ttggcgtataaccactttggaaagagattggatcaaaggatgcctagatgcaggtttgga
tttttccatctggtgaacaatgattacactcattgggaaagatacgctattggaggaagc
agtggagcgacaatcatcagccaagggaataggtttattgcggaggataaattgttggtg
aaagaggtgacatatagagaaaaaagtacatcaagtgttgaagaatggatgaaatggaca
tggataacagatggtgatgatttcgaaaatggtgctacatttacaccatctggtgaccag
aatttactctctaaaattgaccatctcaatttgattcaaccagagccctcttctaaagtt
ggattactaactaagttttctggtgctttgtcttgcaagattcgacgcccatgttaa

DBGET integrated database retrieval system