KEGG   Solanum lycopersicum (tomato): 101254419Help
Entry
101254419         CDS       T02665                                 

Definition
(RefSeq) GPI transamidase component PIG-T
  KO
K05292  GPI-anchor transamidase subunit T
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    101254419
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 101254419
NCBI-ProteinID: XP_004247080
UniProt: A0A3Q7I2T5
Position
9
AA seq 661 aa AA seqDB search
MVRLRSILLFLLLFKSFGSIIAEEEDQIEQFSEALLLRPLPDRKVLAHFHFESKVPPTRT
HGSHHHLFPKSIYQLVHKFRVQEMELSFTQGRWNYARWGGYDPISSRNAKPPGVELWATF
DVPQHQVDASWRNLTHALSGLFCASINFLESSTAYSSPQWSFKSFATNIRYGTLPREAVC
TENLTPWLKLLPCRDKAGLSALMDRPSIYRGFYHSQRLHLISNEFDLAAASSGMVLEQTL
TVVLQPVTLGSGMTSSVGSIQQPSWSLSTLFGRKVSGRCVLSNASNVYVQLEPDLVSELK
TTSETQQQSDVGNLISEAWSDMSFEMSESAVRVIKEANGFLKESSLLYEFSLENYSDSRP
FDLEFRWKRPVTWSSQLAPLQARRFLMGSGNERGAIAISLKSVGRSEYAKSSVNEEGRCL
LRVDVFQVVPWYVKVYYHTLKVFLDERLHSLADVVERTNVSPSEDKVSPGLMEIALRLPC
DVHSVILTLEFDKGFLHIDEYPPDANQGFDIPSALIRFPGIKTKMDLFEDKSACKSPILS
KLQEESPVLWYTEVLLVPLTTPDFSMPYNVITITCTVFALYFGSLLNALRRRVDEEERLL
KNKAAKPSGPIGVLLSKLSAKLRGKPLEPPPPSSSSKVSYKLILRVILVAGIAAAWQYFY
G
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atggttcggttaagatcaattttgctttttcttctgctctttaagagtttcgggtcaatt
attgccgaagaggaagatcaaattgaacagttctcagaagcactcttgttgaggccattg
ccagatcgtaaagtgcttgctcattttcatttcgaaagtaaagtcccaccaactcgaaca
catggcagccaccaccaccttttccccaaatccatttatcagctggtccataaatttaga
gttcaagaaatggagctgtcgttcacacaaggtcgctggaattatgcacgctggggtgga
tatgatcccatttcaagtagaaatgcgaagcctcctggagttgaactctgggctactttt
gatgttccacaacatcaggtcgacgcttcgtggagaaatttaacacacgctctttcaggg
ctcttttgtgcttctattaacttcctagagtcatcaactgcttattcttctcctcaatgg
agcttcaagtcatttgctacaaatatcagatatggcaccttgccccgtgaggctgtttgc
acagagaacctcactccctggctaaagttgcttccttgccgagacaaagctggactttct
gcattgatggacagaccttctatctacagaggattttatcactctcagaggttgcattta
atctcaaatgaatttgatctagctgcagcaagttctggaatggtgcttgaacagacactt
actgttgttctccaaccggttactttaggaagtggcatgacatcatctgttggctcaata
cagcagccaagttggtcactgagcacattgtttggacgaaaagtaagtggaaggtgtgtt
ctttcaaatgctagtaatgtgtatgtccaattagagccggatttggtgtctgaattgaag
actacttcagagacgcaacagcaatctgatgttgggaatttgatatctgaagcttggagt
gacatgagctttgaaatgtctgagtccgcagtcagggtaattaaagaagctaatggcttt
ctgaaggagtcatcccttctatatgaattttctctagaaaattatagtgattcaaggcca
ttcgacttggagttcaggtggaagcgtcccgtgacttggtcatctcaactggcacccttg
caggctcgcaggttccttatgggaagtgggaatgaaaggggtgccatagccatctccttg
aagtctgtaggtagaagtgagtatgcaaaatcttctgtcaacgaggaaggaagatgcttg
ttacgtgttgatgtattccaagtagtgccttggtatgtcaaggtttattaccatacactt
aaagtgtttctagatgaacgtcttcacagtttagcagatgttgtagaaaggacaaacgtt
tcgccttctgaagacaaggtttcccctgggctaatggaaatagcattgcggttgccatgt
gatgtgcactcggtgatattgacattggagtttgataagggttttctgcacatcgatgag
tatcctccagatgctaaccagggatttgacattccatcagctttaatcaggtttcctggg
atcaaaacaaagatggatttatttgaggataaatctgcttgcaagtcacctatcttatcc
aagctacaggaagaaagccctgttctatggtacacagaagtactgcttgtacccttgacc
actcctgattttagcatgccatacaatgtcatcacgattacatgcactgtatttgctcta
tattttggatcactgcttaatgcgttacgtaggcgtgttgatgaggaggagaggcttctg
aaaaataaagctgccaagcccagtggtccgataggcgtgctactgtccaagttatcagct
aaattgagaggaaaaccgttggaaccaccgcccccatcctcttcatcaaaagtcagttat
aagctgattctcagagtgatactggtggctggtattgctgctgcttggcagtacttctat
ggatga

DBGET integrated database retrieval system