KEGG   Solanum lycopersicum (tomato): 101254910Help
Entry
101254910         CDS       T02665                                 

Definition
(RefSeq) pyruvate decarboxylase 2 isoform X2
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101254910
Enzymes [BR:sly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     101254910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 101254910
NCBI-ProteinID: XP_010323135
Position
6
AA seq 586 aa AA seqDB search
MDNANGTSCIQNSHSSSVIASPDANLGRHLARRLVEIGVEDVFSVPGDFNLTLLDHLIAE
PRLKNVGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAIAGAYSENLPIICIVG
GPNTNDYGTNRILHHTIGLPDFSQELRCFQTVTCYQAVINNLEDAHEQIDRAISTALIER
KPVYISVSCNLPATPHPTFSRDPIPFFLSPRLSSKKGLEAAVDAAVAFLSKAVKPVMIGG
PKLRVAKACDAFAELADSSGYAMAMMPSAKGLVPEKHPHFIGTYWGAVGTSYCAEIVESA
DAYLFAGPVFNDYSSVGYSLLIKREKALIVQPDRVVIGNGPAFGCVLMKDFLSELAKKVK
KNETAYDNYRRIFVPEGTPPKPEPNEPLRVNVLFQHVQKMLSADTAVIAETGDSWFNCQK
LKLPEGCGYQFQMQYGSIGWSVGATLGYAQSEPKKRVVSFIGDGSFQVTAQDVSTMIRCD
QKTIIFLINNGGYTIEVEIHDGPYNVIKNWNYTGLVDAIHNGEGNCWTQKVRTEEELIEA
IATATGEKKDCLCFIEVIVHKDDTSKELLEWGSRVCSANGRPPNPQ
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atggacaatgcaaatggcacttcttgtatccaaaactcacattcttcttccgttatcgcg
agccctgacgcaaacttagggcgccatttagcccgaaggttagttgaaattggcgttgag
gatgttttctcagtgccaggtgatttcaacctcacacttcttgatcacctcattgctgag
ccaaggcttaagaatgttggttgttgcaatgagcttaatgctggatatgctgctgatggg
tacgcaagatctcgaggcgttggtgcgtgtgttgtcacgttcactgtgggtgggcttagt
gtgatcaatgctattgctggtgcttatagtgagaatcttcctattatctgcattgttgga
ggtcctaatactaatgactatggaactaatagaatacttcaccatactatcggattacct
gatttcagccaagaactaagatgttttcagactgttacatgttatcaggctgtgataaat
aacttggaggatgcacatgaacaaattgatagagcaatctctactgctctaattgaaaga
aagccagtatatattagtgtcagttgcaatttgccagccacccctcatccaacattcagc
agagatcccatcccattttttctatcaccaaggctaagtagcaagaaggggttggaagct
gcagtggatgcagctgtggcctttctaagcaaggcagtaaaaccagtgatgattggaggg
ccaaagctaagagtagctaaagcttgtgatgcttttgctgaacttgctgattcttctggt
tatgccatggcaatgatgccatcagcaaaagggctagtaccagaaaaacaccctcacttc
attggcacttactggggtgcagtaggcacatcctattgcgcggaaattgttgaatcagct
gatgcttacttgtttgctggtccagtttttaatgattacagctctgttggttactcactt
ttgatcaagagagaaaaggcgttaatcgtgcagcctgatagagttgttattggaaatgga
ccagcatttggttgtgtcctaatgaaagatttcctctctgaactagcaaagaaagtaaag
aaaaacgaaactgcttatgataactaccgtcggatctttgttcctgaaggaactcctcca
aaaccagagcctaacgaacctctacgagtcaatgttctgttccaacatgtgcagaagatg
ctttcagctgatacagctgtgattgctgagacaggggattcatggttcaattgccagaag
cttaagttaccagaaggatgtgggtatcaattccagatgcaatatggctccattggttgg
tctgttggtgctaccctgggttatgcacaatctgaacccaaaaaacgtgtcgtatctttc
atcggtgatggaagttttcaggttactgcacaagacgtgtcgacaatgattcgttgtgac
caaaagactatcattttcttgattaataatggtggttacaccattgaggttgaaatccat
gatgggccatataatgtcatcaagaactggaactacactggtttggtagatgcaattcac
aatggtgaaggcaattgctggacccaaaaggtaaggacggaagaggagctgatagaagca
atcgcaactgcaactggagagaagaaagattgtttatgtttcattgaagttattgttcac
aaggatgatactagcaaagagttgcttgaatggggatctagagtctgttctgccaatgga
cgtccaccaaaccctcaatga

DBGET integrated database retrieval system