KEGG   Solanum lycopersicum (tomato): 101255518Help
Entry
101255518         CDS       T02665                                 

Definition
(RefSeq) probable L-type lectin-domain containing receptor kinase S.7
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sly01001]
    101255518
Enzymes [BR:sly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101255518
Protein kinases [BR:sly01001]
 Serine/threonine kinases: TKL group
  IRAK family
   101255518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 101255518
NCBI-ProteinID: XP_025888396
Position
8
AA seq 235 aa AA seqDB search
MLTGTAASGPQVFTYQKLSKATKGFSKDNLLGTGGFGSVYKGVFYDSATTVAVKQINVTS
KQGWCYDGEKLLLVYEYMPNGSLDKYIGKIFLDWDTRFKILSGLESSLVYLHEECGNPIV
YRDIKPNNVMLDTKYNAHLGDFGLARLLQNENFVTTMVAGTPGYLAPEVSYTGRATPESD
VYSFGMVVLEVVCGRRSKGIMDENSLVDKCVPNKVGMTVVPNEKNDLVSMSPVTG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgctaacaggaactgcagctagtggtccacaggtatttacttaccagaaactctccaag
gctactaaaggcttcagcaaagataacttattgggaactggaggctttggtagtgtttac
aagggggtgttttatgattctgctacaacagtagctgttaaacaaatcaacgtgacatct
aagcaaggctggtgctatgacggagagaaactcctgttagtgtatgagtacatgccaaat
ggaagccttgataaatacatcggcaagatttttcttgattgggacaccagattcaagatt
ctatcaggtctagaatcatcacttgtgtatcttcatgaagaatgtggtaatcctattgta
tatcgagacattaagccgaacaatgtgatgctagacaccaagtataatgctcacttgggt
gattttgggctagcaagattactccaaaatgagaactttgttacaacaatggtggctggc
actccaggatacctagcaccggaagttagctatacagggagagctaccccggagtctgat
gtctatagttttggaatggttgtattagaagtggtatgtggacgaagatcaaaagggatt
atggatgaaaatagcttagtcgataaatgtgtacctaataaagtgggaatgactgtggtc
cctaatgagaaaaatgatcttgtttcaatgagtccggtgactggatga

DBGET integrated database retrieval system