KEGG   Solanum lycopersicum (tomato): 101256786Help
Entry
101256786         CDS       T02665                                 

Definition
(RefSeq) external alternative NAD(P)H-ubiquinone oxidoreductase B3, mitochondrial
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101256786
Enzymes [BR:sly01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     101256786
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_8 p25-alpha EF-hand_7 EF-hand_1 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 101256786
NCBI-ProteinID: XP_004243314
Position
7
AA seq 575 aa AA seqDB search
MSGYSFFQRASRAFNDYPHLPKLLVLFTVSGGGLATVCHTAFADAGQDDIIKKKKKIVVL
GTGWAGTSFLKNLKDPSYSVQVVSPRNYFAFTPLLPSVTCGTVEARSIVEPIRNIVKKKN
FDAEFKEAECYKIDTVNKKVHCKTTQPIHLGGGIEDFTVDYDYLVIAMGARANTFNTPGV
VENAHFLKEVEDALRIRRTVIDCFEKASLPSISEAEKKRILHFVIVGGGPAGVEFAAELH
DFVKEDLAKLYPALKEYVSITLLEAGDNILNMFDKRITAFAEEKFARDGIELKTGSMVVK
VSDREISTKERSTGQTVIIPYGMCVWATGIGSRPVVMDFMKQIGQTNRRILATDEWLRVE
GCKDIYALGDCATVNQRSVMEDISIIFSKADKNNSGNLRVEDFKEVIQDICERYPQVELY
LKKKQLKNFNALLKGSEEVAEINIEKFKKLLAEVDSQMKNLPATAQVAAQQGSYLADCFN
RLQICEANPEGPLRFRGTGRHRFHPFRYRHLGQFAPLGGEQTAAQLPGDWVSIGHSTQWL
WYSVYASKLVSWRTRVLVVSDWIRRSTFGRDSSRI
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgagtggttatagtttttttcaaagagcctctagggctttcaatgactaccctcatctt
cctaaacttcttgtgcttttcactgttagtggcggagggctagctactgtatgtcacact
gcatttgctgatgcaggtcaggatgatattattaagaagaagaagaaaattgtagtgctt
ggaacaggctgggcaggaacaagttttcttaagaatttgaaagacccttcttattctgtc
caagtcgtgtctcctcgcaactattttgcctttactcctctgttacctagtgttacttgt
ggtacagttgaagcaaggagcatcgtagaaccaattcgtaatattgtgaaaaagaaaaac
tttgatgctgaattcaaggaagctgagtgttataagattgacacagtaaacaagaaagtt
cactgtaaaacaacccaaccaattcatttgggtggtggtatagaagattttaccgtagat
tatgactacttggtgattgctatgggcgctcgagcaaatactttcaacacccctggtgtt
gtggagaatgcacactttctaaaggaagtcgaagatgcactgagaattcgtaggactgtg
atagattgtttcgagaaggcaagccttccaagcataagtgaagctgagaagaagagaatt
cttcactttgtgattgttggaggtggtccagcaggtgtagagtttgctgcagagcttcac
gattttgtgaaagaggacctcgccaagttgtatcctgcacttaaagaatacgtcagtata
acactacttgaggccggagataatatactcaacatgtttgacaaaagaattacggccttt
gctgaggaaaaatttgctagagacggtatcgagctgaaaactggatcaatggtggtgaaa
gtaagtgatcgtgaaatatcaactaaagagagaagcactggacaaactgttatcatacca
tatggaatgtgtgtctgggctactggcattggatctcgtcctgtcgttatggatttcatg
aagcaaattggtcagacaaacaggcgaatcttagcaacagatgaatggctcagagttgaa
ggatgcaaagatatttatgctctaggagattgcgccacagtaaaccaacgcagtgtcatg
gaagatatttcaatcatatttagcaaggcagacaagaacaattcaggtaatctaagggtg
gaagattttaaagaagtgatccaagacatatgtgagaggtaccctcaagtggagctttat
ctgaagaaaaagcagttgaaaaactttaatgctttactaaagggttcagaagaagttgct
gaaattaacatcgaaaagttcaagaaactacttgctgaagtagactctcagatgaaaaat
cttcctgctacagcacaggttgcggctcaacaaggtagctacctcgctgactgtttcaat
cgcttgcaaatatgtgaagcaaatccagaaggtccactaagatttagaggaacagggcgc
catcgcttccatccttttaggtataggcatttggggcaatttgcacctttgggtggggaa
cagactgcagctcaactccctggagactgggtttccataggtcacagtactcagtggctc
tggtattcagtatatgcaagcaagctagtcagttggcgtacaagggtgttggtggtatct
gattggataaggcgttccacatttgggagggattctagcagaatctga

DBGET integrated database retrieval system