KEGG   Solanum lycopersicum (tomato): 101256823Help
Entry
101256823         CDS       T02665                                 

Definition
(RefSeq) probable serine/threonine-protein kinase PBL7
Organism
sly  Solanum lycopersicum (tomato)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 101256823
NCBI-ProteinID: XP_004231989
UniProt: A0A3Q7FAU1
Position
2
AA seq 517 aa AA seqDB search
MGFIPNSFTNSVEPLHSSYPLKTQALATDTDNHCGNEELKIKSLIYRMIWDFGLACFVPT
RRRRASGEDNGEKDEGVSSLEHNKAWLLAESGACGTELINAEPHSVHSSFRFSFCSQVEL
ESMNVNKCSSATVLMVNLDNGLTDPLSRELKWRKIQSLERSISPVTHSLIRFTYPEIASA
TRNFSKGRVLGRGALSYVFRGRVGFMRTTVAIKRLDREDKESPKAFCRELMIASSLHNPY
IVPLVGFCIDPEEGFFLVYKYVSGGSLERYLHDKKKRGVKGGPVLPWSTRYKVAVGIADS
IGYLHYGTERCVVHRDIKPSNILLSSKKTPKLCDFGLATWTPAPSVPFLCKTVKGTFGYL
APEYFQHGKVSDKTDVYAFGVVLLELLTGRKPIEAKRGPGEENLVLWAKPLLQQGSLEKF
LDPRLKFPQKNLQQIARMTQAAAACIHTEESRRSNMDEITAILRGTEVRSLTRKKSISSN
NCVIDPQLQRTKSEMNSHLALAMLGVPDFEDDDFYCR
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atggggtttattccaaatagttttactaactctgtggagcctcttcacagttcataccct
ttaaagactcaagctttagccactgatacagataaccattgtggaaatgaagagttaaaa
atcaagtctttaatatacagaatgatttgggattttgggttggcttgttttgttccgacc
cgtcgccggcgagcttccggcgaggataacggtgagaaggatgaaggtgttagcagtttg
gagcataataaggcttggttgcttgctgagtcaggagcatgtggtactgagttgattaat
gcggagccacattcggttcattcctcttttaggtttagtttttgctctcaggttgagctt
gagtctatgaatgttaataaatgttcttctgccactgttttgatggtgaatttggataac
gggttaactgatcccctgtctagagagctaaaatggaggaaaattcaatcacttgagagg
agtatttctcctgtgactcattctttaattaggtttacctatcctgagattgcttctgct
actaggaatttttcaaaaggtagagttttgggaagaggagcattgagctatgttttcaga
ggaagagttggatttatgaggactactgttgcgattaagcggttagatagggaagacaag
gagtctccaaaggcattttgtagggagttaatgattgctagttctcttcacaacccatac
attgttcctctggtgggtttttgtattgatccagaggagggtttctttttggtatacaag
tatgtatctggtggaagtttagagcggtatttacatgataagaagaagaggggagtgaag
ggtggtccagtacttccatggtctacgcggtataaggtggctgtaggcattgctgattca
atcgggtacttgcattatggcactgagaggtgtgttgttcacagggacatcaaaccctcc
aacattcttctctcatccaaaaagacgcccaagttgtgtgactttggtttagctacatgg
actcctgcaccttctgtacctttcctttgtaaaacagttaaaggaacctttggctattta
gctcctgaatattttcagcatggtaaagtgtccgataaaaccgatgtttatgcctttgga
gttgtcctcctggagctgctaactggaaggaagccaattgaagcaaaaagaggaccagga
gaagagaacttagtgttgtgggcaaagccactgctgcagcaaggatctcttgaaaagttt
cttgatccaagactcaaattccctcaaaagaacctacaacaaatagctcggatgactcaa
gcagcagctgcatgtatacacactgaagagtctcgaaggtccaacatggatgagatcact
gccatattgagaggcacagaagttcgttccttgacgaggaagaagtctatttccagtaat
aattgtgtgattgatccccaattgcagcggacaaagagtgaaatgaatagtcacttagca
ttggcaatgttaggagtacctgactttgaagatgatgatttttattgtcgttaa

DBGET integrated database retrieval system