KEGG   Solanum lycopersicum (tomato): 101256938Help
Entry
101256938         CDS       T02665                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase CYP59-like
  KO
K12735  peptidyl-prolyl cis-trans isomerase-like 4 [EC:5.2.1.8]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:sly03041]
    101256938
   03110 Chaperones and folding catalysts [BR:sly03110]
    101256938
Enzymes [BR:sly01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101256938
Spliceosome [BR:sly03041]
 Complex C
  Other components
   PPlases
    101256938
Chaperones and folding catalysts [BR:sly03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101256938
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 101256938
NCBI-ProteinID: XP_010317252
Position
2
AA seq 326 aa AA seqDB search
MSVMIVTSLRDITVDLFTDECPLTCKNFLKLCKIKYYHNCIFHTIRKNFTIQTGDPTGTG
SAGDSIYKFLYGSQARFFSDEIHPNLKHSQMGTVAMASRTGTSEKNLNASQFYITLRDDL
DSLDGEHTVFGEITEGFDTLNRINEAYVDDKGKPYQNIRIKHTYILYDPSQLDDLIPDAS
PERNLKDEIDDDVRLEDDWMPKDEELGVREEKEAHSXKSVGDIPDAEMKPPENLLFVCKL
NPSTEEEALYIIFSRFGTVTSAEIIRDHKTGNSHCYAFIEFEDKESCEQAYFTMDNTKID
DRRIRVDFSQSVAKLWPQLIDDLETK
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcatgattgtgacaagtttaagggacataacagttgatttgtttacggatgaa
tgtcctttgacatgtaaaaattttcttaaattatgcaagataaaatactatcataattgt
atctttcataccattcggaagaatttcaccatccagacaggagatccaactggaacagga
tccgcaggggattccatatacaaatttttatacgggagtcaggctcgtttttttagcgat
gagattcatccaaacttgaagcattcacagatgggaacggttgctatggctagtcgcact
ggtactagtgagaagaatctaaatgcttctcagttttatatcacgttacgtgatgatctg
gattctcttgatggagagcatactgttttcggagagattacagaaggatttgacacgtta
aataggataaacgaagcttacgtggatgacaagggcaagccttatcaaaatatacgaatc
aaacacacttacatattgtatgatccttcccagttagacgacttgattccagatgcttca
cctgaaagaaatttgaaagatgagattgatgatgatgttcgactagaggatgattggatg
ccaaaggatgaggaattaggggttcgtgaagagaaggaagcacactccncgaaaagtgta
ggagacattcctgatgctgagatgaaaccccctgagaatttgctctttgtttgtaaatta
aatccgtcaactgaagaggaagcactatatataatcttctcgcggtttggaaccgtgaca
tctgctgaaattatcagagatcacaagactgggaatagtcactgttatgctttcatcgag
tttgaggacaaggagtcctgtgagcaagcatattttacgatggataatactaaaattgat
gatcgaaggatacgagttgattttagtcagagtgtagcaaagttatggccccaattgata
gacgacctagaaaccaaatag

DBGET integrated database retrieval system