KEGG   Solanum lycopersicum (tomato): 101257163Help
Entry
101257163         CDS       T02665                                 

Definition
(RefSeq) protein disulfide isomerase-like 1-4
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sly00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101257163
Enzymes [BR:sly01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101257163
Chaperones and folding catalysts [BR:sly03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101257163
Membrane trafficking [BR:sly04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101257163
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101257163
  Exosomal proteins of colorectal cancer cells
   101257163
  Exosomal proteins of bladder cancer cells
   101257163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_7 Thioredoxin_8 OST3_OST6 Thioredoxin_2 AhpC-TSA ERp29_N Thioredoxin_3 Redoxin
Motif
Other DBs
NCBI-GeneID: 101257163
NCBI-ProteinID: XP_004237540
UniProt: K4BRS2
Position
4
AA seq 563 aa AA seqDB search
MAMKKYLILSIFLLNLIFFRTAFSSVVEEEEDLSFLEEEDSDAHSDSNPYGDHHDFENYE
DLEDDSSDHGEDSYEPPAVDEKDVAVLKEGNFSEFISKNKYVMVEFYAPWCGHCQALAPE
YAAAATELKGENVMLAKVDATEEAELAQKYDVQGYPTVFFLIDGVHKTYNGERNKDAIIS
WIKKKTGPVLSNITTVEEAEQILKDEKKVVLGYLNDLVGDKSEELAAAAALEDDVNFYQT
ANPDVAKLFHIDSQAQRPALVIIKKEAENINHFDGEFTKSAIAKFVFENKLPLVTNFTRE
SASEIFENPITKQLILFATSKDSEKFLPIFQEAVKAFKGKLICVFVEIDNEDVGKPVSEY
FGVSGDAPRVLAYTGNEDGRKFILEGEITLDGVKSFGEKFLEDNLKPFYKSDPIPETNDG
DVKIVVGNNFDEIVLDESKDVLLELYAPWCGHCQSLEPIYNKLGKHLRGIDSLVIAKMDG
TTNEHPRAKSDGFPTLLFFPAGNKSFEPITVDTDRTVVAFYKFLKKHASTPFKIQKPVST
QRTTESDASLSHESTTNDAKDEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagaaatatctaattctctccatttttctactcaatctcatcttcttcaga
actgctttctcttctgttgttgaagaagaagaggatctcagtttccttgaagaagaggat
tccgatgctcattcagattccaatccatatggtgaccaccacgattttgagaactacgaa
gatctcgaggacgattcttccgatcacggagaagactcgtatgagccgccagcagtggat
gagaaggatgtggctgtattgaaggaagggaattttagtgaatttatttcgaagaataag
tatgttatggttgagttctatgcgccgtggtgtggtcattgtcaggcacttgcaccggag
tatgctgcagccgcgactgagctgaaaggagagaatgtgatgcttgctaaagtagatgct
actgaggaagctgaacttgctcaaaagtatgatgtgcaagggtatcccactgttttcttc
ctcattgatggtgttcacaagacctataatggtgaaaggaataaggatgctattatttca
tggataaaaaagaagaccgggcctgttctatccaatataacgactgtagaggaggcagaa
caaatcttgaaagatgagaaaaaagtagtgttgggttatttgaatgatttggtgggtgat
aaaagtgaagagcttgctgcagctgctgcactagaagatgatgtcaacttctatcagact
gccaatccagatgtggcaaaactcttccatattgattctcaagcccaacgtccagctctt
gtcataattaagaaagaagccgagaatatcaaccactttgatggtgaattcaccaagtca
gcaatagctaagtttgtttttgagaacaagcttcctcttgtcaccaattttactcgggaa
agtgcctcagagatatttgaaaatcccattacgaagcagttgatactttttgccacttcg
aaagattcagaaaaattcttaccaatatttcaagaagctgtgaaagcttttaaaggaaag
cttatctgtgtgtttgttgaaatcgacaacgaagatgttggaaaaccagtttcagagtac
tttggtgttagcggtgatgccccaagagttctcgcatatacaggaaatgaggatgggagg
aagtttatactggaaggtgaaataaccttggatggtgtcaagtcatttggggagaagttt
ttggaagacaatttaaagcctttctacaaatctgatccaattcctgagactaatgatggg
gatgtcaaaattgtggttggcaataactttgacgaaattgttttggatgaatcaaaagat
gttcttcttgagttatatgctccttggtgtggacattgtcaatcactagaacccatatac
aacaagcttggcaagcatttaagaggcattgactcccttgttattgccaagatggatggt
acaacaaacgagcatcccagagccaagtctgatggattcccaacacttctgttcttccca
gctggcaacaagagctttgaacctattactgttgacacagatcgtacagttgttgccttt
tacaaattcctgaaaaagcatgcatctaccccgttcaagattcaaaagccagtctcaaca
cagagaactacagagtctgatgccagtttaagccacgagagcaccactaatgacgctaag
gatgaactgtga

DBGET integrated database retrieval system