KEGG   Solanum lycopersicum (tomato): 101257192Help
Entry
101257192         CDS       T02665                                 

Definition
(RefSeq) thiamine thiazole synthase, chloroplastic
  KO
K03146  cysteine-dependent adenosine diphosphate thiazole synthase [EC:2.4.2.60]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00730  Thiamine metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101257192
Enzymes [BR:sly01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.60  cysteine-dependent adenosine diphosphate thiazole synthase
     101257192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thi4 DAO FAD_binding_2 NAD_binding_8 Pyr_redox_2 HI0933_like Lycopene_cycl GIDA Pyr_redox_3 GMC_oxred_N NAD_binding_9 FAD_oxidored FAD_binding_3 RNA_pol_Rpb1_3 Amino_oxidase
Motif
Other DBs
NCBI-GeneID: 101257192
NCBI-ProteinID: XP_004244150
UniProt: A0A3Q7HFB9
Position
7
AA seq 354 aa AA seqDB search
MASTLASSVISKTNFIDTHKSSFYGVPISSQTRLKIVKSTPQNMSVSMSADASPPYDLGS
FSFNPIKESIVAREMTRRYMTDMITYADTDVVIVGAGSAGLSCAYELSKNPNVQVAILEQ
SVSPGGGAWLGGQLFSAMVVRKPAHLFLNELGIDYDEQDNYVVIKHAALFTSTIMSKLLA
RPNVKLFNAVATEDLIVKNGRVGGVVTNWSLVSQNHDTQSCMDPNVMEAKIVVSSCGHDG
PMGATGVKRLRSIGMINSVPGMKALDMNAAEDAIVRLTREVVPGMIVTGMEVAEIDGAPR
MGPTFGAMMISGQKAAHLALRALGLPNALDGTAETSVLPELMLAAADEAEIADA
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaccttagcttcctctgttatttccaagactaatttcattgacacacacaaa
tcatccttctatggcgttccaatttcatcacaaactcgattgaaaatcgttaaatcgact
ccacaaaacatgtctgtttccatgtctgctgatgcttctcctccttacgatctcggaagt
ttcagttttaatccgattaaggaatcgattgttgctcgcgaaatgactcggaggtatatg
acggatatgattacttatgctgatactgatgttgtcattgttggtgctggatctgctggt
ttatcttgtgcttatgaactcagcaagaaccctaatgttcaggtggctattcttgagcaa
tctgtgagccctggtggaggtgcttggctaggtggacaactcttctctgctatggttgtg
cgtaagccagcacatcttttcttgaacgagctaggcattgactacgacgagcaagacaac
tacgtggtcatcaaacacgctgccttgttcacctcaaccatcatgagcaagcttttggcc
aggccaaatgtgaagctcttcaatgctgttgcaacagaggaccttatcgtgaagaacgga
agagtcggtggtgttgtcactaactggtctttggtttcccagaaccacgacacacaatcc
tgcatggaccctaatgttatggaggctaagattgtggtcagctcttgtggccacgacggc
cccatgggcgccaccggtgttaagaggctcaggagcattggcatgatcaacagtgtccct
ggaatgaaagctttggacatgaacgctgctgaggacgcgattgttagacttaccagagag
gtcgtacctggtatgattgtcacaggaatggaagttgctgaaattgatggagcaccacga
atgggtccaacttttggagctatgatgatatcaggacagaaggcagctcacctcgcccta
cgagcgttgggattgcccaacgcccttgatggaactgcagaaacaagcgtcctcccggag
cttatgttggctgcagctgatgaagctgaaattgctgatgcttga

DBGET integrated database retrieval system