KEGG   Solanum lycopersicum (tomato): 101259176Help
Entry
101259176         CDS       T02665                                 

Definition
(RefSeq) long chain acyl-CoA synthetase 4-like isoform X1
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00061  Fatty acid biosynthesis
sly00071  Fatty acid degradation
sly01100  Metabolic pathways
sly01212  Fatty acid metabolism
sly04146  Peroxisome
Module
sly_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101259176
   00071 Fatty acid degradation
    101259176
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101259176
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sly01004]
    101259176
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sly04147]
    101259176
Enzymes [BR:sly01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     101259176
Lipid biosynthesis proteins [BR:sly01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   101259176
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   101259176
  Exosomal proteins of breast cancer cells
   101259176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C EIAV_GP90
Motif
Other DBs
NCBI-GeneID: 101259176
NCBI-ProteinID: XP_004244632
Position
8
AA seq 657 aa AA seqDB search
MAEKFIIEVEPAKPAKDGKPSVGPVYRSKFAKDGFPPPIEGLNSCWDIFRLSVEKYPNNR
MLGHRKIVDGKPGKYVWKTYKEVYDIVIKVGNSIRNCGVEKGGKCGIFGANCAEWIISME
ACNAHGLYCVPLYDTLGAGAVEFIISHAEVAIAFVEEKKVPELLKTFPNAAKYLKTVVSF
GEVTPQQKEEIEKFGVSLYSWDEFLQVGSKNQYDLPLKEKTDICTIMYTSGTTGEPKGVM
ISNNSIVTLIAGVKRFLESVNEALTMSDVYLSYLPLAHIFDRAIEECFIRHGASIGFWRG
DVKLLTEDLGELKPTVFCAVPRVLDRIYSGLQQKISSGGRLRSTLFNIAYARKLQYLKDG
CKYHEASPISDKVVFSKVRDGLGGKVRLILSGAAPLSSHVEAFLRVVACAHVLQGYGLTE
TCAGTFVSLPNQFDMLGTVGPPVPNVDVCLVSVPEMEYDALSSTPRGEICVRGDTLFSGY
YKREDLTKEVLIDGWFHTGDIGEWQPNGSLKIIDRMKNIFKLSQGEYVAVENLENVFGNN
PVIESVWVYGSSFESFLVAVVNPSKQQVEKWAKQNSLSGDFNSLCENSKVKEHILGELTK
VGKEKKLKGFEFIKALHLDPVPFDMERDLLTPTFKKKRPQLLKYYKDVIDTMYKDAK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaaattcatcatcgaagtggagccggcgaagccagcgaaagatggaaagccg
tcagtcggaccggtttatcggagtaaattcgcgaaagacggttttccaccgccgattgaa
ggcttaaacagctgttgggatattttccgtttgtcagtggagaaatatccaaacaaccga
atgcttggccaccgtaagattgtggatgggaagcctgggaagtatgtgtggaagacttac
aaagaagtgtatgacattgtcataaaagtagggaactccatccgaaattgtggtgtagaa
aaaggagggaaatgtggtattttcggtgccaattgtgctgagtggattatcagcatggag
gcatgcaatgctcatggactttactgtgtccctctgtacgacaccttgggtgctggtgca
gtggaatttatcatttcccatgcagaagttgcaattgcttttgttgaggagaaaaaagtt
cccgagcttttgaaaacatttccaaatgctgcaaagtacttgaagacggttgtgagtttt
ggggaagtgactcctcaacaaaaggaggagatcgaaaagtttggagtgtctctttattcc
tgggatgagtttctgcaagtaggaagcaaaaatcagtatgatcttccactgaaggagaag
actgatatctgtacaataatgtataccagtggaacaaccggagaacccaagggtgtgatg
atctcaaataatagcattgttactcttatagctggagtgaagcggtttcttgagagtgta
aatgaggcgctgacaatgagtgatgtatatctctcatatctccccttggcacatatcttt
gatcgggcgattgaagaatgtttcattagacatggcgcctcaataggattttggcgaggg
gatgtcaaattactaactgaagaccttggagagctgaaaccaactgtcttctgtgcggta
cctcgggtattagacagaatatattcaggtttgcaacagaaaatttcttcagggggtcgg
ctaagaagcacgttgttcaatattgcatatgctcgaaaacttcaatatttgaaggatggg
tgtaaatatcacgaagcatctccaatatctgacaaagttgtttttagtaaggtaagagat
ggtctaggaggaaaagtacgtcttatattatctggagcagcacccctctcttctcatgta
gaagcttttctgcgagttgtagcatgtgctcatgttcttcagggatatggtcttactgaa
acatgtgctggtacatttgtatcactacctaaccagtttgatatgcttggtacggttggt
cctccggtgcccaatgtggatgtgtgcttggtgtccgttcctgaaatggaatatgatgct
ctttcaagcacaccacgtggagaaatatgtgtgaggggagacactctgttttctggttat
tacaagcgtgaggatctgacaaaagaagtcttgattgatggatggttccatacaggggat
attggtgagtggcaaccaaatggtagcttgaagataattgatcgcatgaagaatattttc
aagctatcacaaggagaatatgttgcagtcgaaaatttggagaatgtatttggcaataat
cctgttattgaatcggtatgggtatatgggagcagctttgagtctttccttgttgctgtt
gttaatccaagtaaacaacaggttgaaaaatgggccaaacagaatagcctctcaggggat
tttaattccctctgtgaaaattcaaaggtgaaagagcacatattaggggagctcacaaaa
gttggaaaagaaaagaagctgaagggatttgagttcataaaagctctacaccttgatcca
gttccatttgacatggaacgtgacctcctgactccaacatttaagaagaaaagaccacaa
ttgcttaaatactacaaggacgtgattgacaccatgtacaaggatgctaaatga

DBGET integrated database retrieval system