KEGG   Solanum lycopersicum (tomato): 101260052Help
Entry
101260052         CDS       T02665                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00010  Glycolysis / Gluconeogenesis
sly00562  Inositol phosphate metabolism
sly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101260052
   00562 Inositol phosphate metabolism
    101260052
Enzymes [BR:sly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     101260052
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     101260052
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 101260052
NCBI-ProteinID: XP_004239950
Position
5
AA seq 502 aa AA seqDB search
MLKNSMNFAPLLLLQLLLIAIAVQYSTADESFDVRQHLSTVSRYGIVKDIADDSFVPSLN
LDQCTPIHLNLVARHGTRAPTKKRIRELEAFAVRLEVLVRDVKEQKQSLDKIPAWLMGWN
SPWKGKGTGGELISEGEDELYHLGIRVREQFPSLFSEEYHPAIYSIKATQVPRASASAVA
FGMGLFSGKGKLGPGGHRAFAVTSESRASDTVLRFHDCCQSYKDFRRSQEPTVKKLKEPI
LDEITHELVTQYGLNFTKQDVSSLWFLCKQEASLLNITNQACSLFSPAEVSLLEWADDLE
LFILKGYGNSLNYRMGVPLLEDVIQSMEQAIKAKEEGYAPASYEKARLRFAHAETLLPFS
CLIGLFLKESEFELIQREQTLQYPPKPPKTRNWRGNLVAPFAGNNMLVLYSCTSDNSSKY
FVRVLHNERPIPIPGCNGSDSCPFEVFKERIAAPHLKHDYNSLCNVNSEQEKKDSSPSMF
SQMFGWIFSQRNSDAPTQKVEL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaactccatgaattttgctccgttactgctccttcaacttctactcattgca
attgcagtacaatactcaaccgctgatgaatccttcgatgttcgtcaacatctatcaact
gtatcgaggtatggtattgtgaaggatatagctgatgattcttttgttccttccctaaat
ctcgatcagtgtacacctattcatttgaatcttgtggcgcggcatggaactcgtgctcct
acaaagaaaagaatcagggagctagaagcctttgctgttcgattagaagtccttgtacgt
gatgttaaggaacagaagcagtctttggataaaattcctgcttggttaatggggtggaac
tctccttggaagggcaaaggtacaggcggagagttgatcagcgaaggagaagatgagtta
tatcatcttggtatcagagtcagagaacagtttcccagcctgttcagtgaagaataccac
cctgctatatattcaatcaaggctacccaggttcctcgggcatcagctagcgctgtggca
tttggcatgggtctgtttagtggaaaagggaagcttggaccaggaggtcatcgagctttt
gctgttacaagtgaaagccgtgcaagtgatacagttttgagatttcatgattgttgtcaa
agttacaaggattttaggagaagtcaggaaccaactgtaaagaagctcaaagaacctata
ttagatgaaattactcatgaactagtgacgcaatatgggcttaattttacaaagcaggat
gtatcttctctatggtttttatgcaagcaggaagcttcactgttgaacatcaccaatcaa
gcttgtagtctattcagtccagcagaggtttctttactggaatgggccgacgatttggag
ttattcatactaaagggctatggtaattcactaaattaccgaatgggagtgccgctactt
gaggatgtgattcaatccatggaacaggcaattaaggctaaagaagaaggatatgctccc
gcgagctatgaaaaagcaagactacgttttgctcatgcagaaactctgcttcctttttca
tgcttgattggactctttcttaaagaatctgaatttgaactaatacaaagagagcagacg
ttgcaataccctcctaagcctcctaaaacaagaaactggcggggaaatttggtggcccct
tttgctggaaataacatgctagtcctttacagctgcacgtcagacaactcaagcaagtat
tttgttagagtgctccacaatgaacggcccattccaataccaggttgcaatggctcggat
tcatgcccatttgaagtatttaaggaaagaatagctgctcctcacttgaaacatgactac
aattctctttgcaatgtgaattcagaacaagaaaagaaggattcttctcccagtatgttc
tcacaaatgtttggttggattttctcacagaggaactctgatgcacccacacagaaggtt
gagctataa

DBGET integrated database retrieval system