KEGG   Solanum lycopersicum (tomato): 101262830Help
Entry
101262830         CDS       T02665                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase, cytosolic 1
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00071  Fatty acid degradation
sly00072  Synthesis and degradation of ketone bodies
sly00280  Valine, leucine and isoleucine degradation
sly00310  Lysine degradation
sly00380  Tryptophan metabolism
sly00620  Pyruvate metabolism
sly00630  Glyoxylate and dicarboxylate metabolism
sly00640  Propanoate metabolism
sly00650  Butanoate metabolism
sly00900  Terpenoid backbone biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
sly01200  Carbon metabolism
sly01212  Fatty acid metabolism
Module
sly_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    101262830
   00630 Glyoxylate and dicarboxylate metabolism
    101262830
   00640 Propanoate metabolism
    101262830
   00650 Butanoate metabolism
    101262830
  09103 Lipid metabolism
   00071 Fatty acid degradation
    101262830
   00072 Synthesis and degradation of ketone bodies
    101262830
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101262830
   00310 Lysine degradation
    101262830
   00380 Tryptophan metabolism
    101262830
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    101262830
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sly04147]
    101262830
Enzymes [BR:sly01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     101262830
Exosome [BR:sly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101262830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 101262830
NCBI-ProteinID: XP_004243582
Position
7
AA seq 404 aa AA seqDB search
MAPAAADTIKPRDVCIVGVARTPMGGFLGSLSSLPATKLGSIAIEGALKKANVDPSLVEE
VFFGNVLSANLGQAPARQAALGAGLPNTVVCTTVNKVCASGLKATMLAAQSIQLGINEVV
VAGGMESMSNVPKYIAEARKGSRLGHDSLVDGMLKDGLTDVYKDCGMGVCAETCASNHKI
TREEQDDYAVQSFERGIAAQEAGAFAWEIVPVEVPGGRGKPSIIVDKDDGLGKFDGAKLR
KLRPSFKDKDGTVTAGNASSISDGAAALVLVSGEKAIKLGLNVIGKISGYADAAQEPELF
TTAPALAIPKAIKSASLEASQIDYYEINEAFAVVSLANQKLLGLNPEKVNVHGGAVSLGH
PLGCSGARILVTLLGVLRQKNGKYGAAGVCNGGGGASALVLELV
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctccagcagcagcagataccatcaagcctagagatgtttgcattgttggtgttgcc
cgtactccaatggggggcttccttggttctctttcctcgttgccagccacaaaacttgga
tcaatagccattgagggtgctcttaagaaagcaaatgttgatccatcactagtagaagaa
gtcttctttggaaatgtcctcagtgcaaacctgggacaggctcctgctaggcaagctgca
ttgggtgcaggactacccaatacggtggtttgcaccactgtgaacaaagtttgtgcatct
ggattgaaagcaactatgcttgcagctcaaagtattcagttgggcatcaatgaggtggtt
gtggctggtggaatggaaagcatgtccaatgttcccaaatacattgcagaagcaaggaag
ggatctcgtcttggacatgatagtctggttgatggaatgcttaaagatggtttgactgat
gtttataaggattgtggtatgggagtttgtgcagaaacatgtgcttctaatcataaaatt
acaagagaggagcaggatgattatgcagttcaaagtttcgaacgtggaattgctgctcag
gaagcaggtgctttcgcatgggagattgtaccggttgaggtgcctggaggaagaggaaag
ccatccattattgttgacaaggatgacggtctaggaaagtttgatggtgcaaaattgaga
aaactccgaccaagttttaaggataaagatggtactgttactgctggtaacgcttctagc
ataagtgatggtgctgctgcattggtcttagtaagtggagagaaggctataaaactagga
ttaaatgttattggaaagatctcaggctacgcggatgctgctcaggaacctgaattattc
acaactgcacctgctctagcaattcccaaagctatcaaaagtgctagcttagaggcttct
caaattgattactatgaaataaatgaagcctttgctgtggtatctcttgcaaatcaaaag
ctgcttggtcttaatccagaaaaagttaatgtacacggtggggctgtatctttggggcat
cctcttggatgcagtggagctcgtatattagttacacttctcggggtgttgagacagaaa
aatggcaaatatggagctgctggtgtttgcaatggaggaggaggtgcctccgcccttgtc
ctagagcttgtgtaa

DBGET integrated database retrieval system