KEGG   Solanum lycopersicum (tomato): 101263515Help
Entry
101263515         CDS       T02665                                 

Definition
(RefSeq) tRNA wybutosine-synthesizing protein 2/3/4
  KO
K15450  tRNA wybutosine-synthesizing protein 3 [EC:2.1.1.282]
Organism
sly  Solanum lycopersicum (tomato)
Brite
KEGG Orthology (KO) [BR:sly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sly03016]
    101263515
Enzymes [BR:sly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.282  tRNAPhe 7-[(3-amino-3-carboxypropyl)-4-demethylwyosine37-N4]-methyltransferase
     101263515
Transfer RNA biogenesis [BR:sly03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    101263515
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TYW3 Met_10 Kelch_6 Kelch_1 Kelch_4 Kelch_3 Kelch_5 Kelch_2 MTS DNA_methylase Cons_hypoth95
Motif
Other DBs
NCBI-GeneID: 101263515
NCBI-ProteinID: XP_004239703
UniProt: A0A3Q7GLB0
Position
5
AA seq 1038 aa AA seqDB search
MEFEKRKLAALSSMNSPEPDKSPKGNIDAPIIPLLNTLNSHPSYFTTSSCSGRISILSQP
ITPITNPTKKKAKGGKWVFISHDPIEPHLILSHLFPSKSIQPVKSVTDVADLHSLVFRFE
PLIIAVECKDIEAAQFLVSLAISSGFRESGITSVNRRVIIAIRCSIRLEVPLGDTEKIMV
SSEYVKYLVELANEKMEVNRKRTDNFLDILLKNGFLGSQISNGEVDCDDSDLLENSLVNG
VNGNGNAKRRDFDDSCSGSEVAPDINLHTVKLVISGESIERLFLWGHSSSTMDDVDKKKV
LIFGGFGGMGRHARRRDLLLLDLECGRMEVIDVLDAPCPRVGHTSSMIGDAMYVIGGRAD
PSNILNDVWVFNVTKKNWRLLECSGTPFLPRHRHAAAAVGSRIYVFGGIHNDMIFSSLYV
FDTQNIEWSEIQVQGDLPCARHSHSMAAYGTQIFVFGGYDGQKALGDLYSFDVKTCVWKK
ENMIGRPPSAKFSHSMFIYKKYLGIIGGCPVSQHNQRLSLLNLESHGWKHISISSIGEGL
FVRCTANIVDTDLIMIGGGAACYAFGTKFSAPVKINLLPLISLIESSIHLHEENMHAICQ
EEKIMGEMNVSFCSPQNAVEAVTNGSFHQNSEGIDSGIARSQMVASHWVLRLKKKDAKMA
KDMLKKLGWLDLGRKAHSQEDGKDICFPVTENFRALFNQRNNLEGVSESVCQSEKDTCMI
ALNILIECGATILADEIVKVKKASHSPFKVMKEAVGSLLSDRGLPLQLLEELPSRWERLG
DIVVLPLTSFKDSAWDLIGQELWFIVAKSLGAIRLARQGRVAPTGTRDSTLEILVGDNGW
VNHRENGILYSFDATKCMFSWGNLSEKLRMGHFDCKDEVIVDLFAGIGYFVLPFLVRAKA
RLVYACEWNPHAVEALRHNLEANLVADRCVLLEGDNRITAPKGVADRVCLGLIPTSEGSW
LTAVRALRDEGGILHIHGNVKDSEEHIWTNHVSQSIQEIARSEGHDWDVTVEHVERVKWY
APHIRHLVADVRCKMIQT
NT seq 3117 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgagaagagaaagttagcagctttatcttccatgaattcaccagaaccagat
aaatcaccaaaaggcaacatagacgcaccaattatccctttactcaacactcttaactca
catccttcgtatttcactaccagttcttgttctggccgtatctccattctttcacaacct
atcacccccataaccaaccccaccaagaaaaaagctaaaggaggcaaatgggtcttcatt
tctcacgacccaattgaaccccatttgattttatcgcatctttttccatctaaatcaatt
caaccagtaaaaagtgttactgacgttgctgatttacatagccttgtgttcagatttgaa
cctttgattatcgcagtggagtgtaaggatattgaggcagctcaatttttggtttcttta
gctatttcatcgggatttagggagagtggtataactagtgttaatagaagagtgattatt
gctatacgatgttcgataagattggaagtgccattaggggatactgagaagataatggtg
tcttctgagtatgttaagtatcttgttgagttagcaaatgagaagatggaagttaataga
aaaagaactgataatttccttgatatattgttgaaaaatgggtttttgggttcacagatt
agtaatggggaagtggactgtgatgattctgatttgttggaaaattctttggttaatggt
gttaatggaaatggaaatgctaaaaggagagactttgatgattcttgttccggatcagaa
gtagcccctgatatcaacctacacactgttaaattggtgatttctggtgaatcaattgaa
aggctatttctctggggtcactcttcttctaccatggatgatgtagataaaaagaaggtt
ctcatatttggtggctttggaggaatgggaaggcatgcacgaagacgtgatctattgctt
cttgatctagaatgtggaaggatggaggtgattgatgttttggatgccccatgtccacgc
gtgggacatacatcatccatgattggagatgcaatgtatgtgattggaggaagagctgac
ccttcaaatattctgaacgatgtgtgggttttcaacgtgacaaaaaagaattggaggctg
ttagagtgttcaggcactccattcctcccaaggcatagacatgctgcagctgctgtaggt
tcaagaatttatgtatttgggggaattcacaatgatatgatattctcatcactgtatgtc
ttcgacacacaaaacattgaatggagcgaaatacaagttcaaggggatttgccatgtgca
cgccattctcattcaatggcagcatatgggactcaaatatttgtatttgggggatatgat
gggcagaaggctctaggggacctgtatagttttgacgtgaaaacatgtgtatggaagaag
gaaaatatgattggtaggccaccatcagcaaaattttcccattctatgtttatttataag
aagtacctcgggataattggagggtgtcctgttagtcaacataatcagagattatcatta
ctcaatctggaatctcatgggtggaagcatatttctatcagttcgattggtgaaggcctg
tttgttcgttgcacagcaaatattgttgatactgacctaataatgattggtggtggggca
gcctgttatgcatttggaacaaagttcagcgcaccagtgaaaataaatctgttacctttg
atatcattaatagaaagttccatccatttacatgaagaaaatatgcatgccatttgccaa
gaagagaaaataatgggagaaatgaacgtttccttttgttccccacagaatgcagtggaa
gcagtaacaaatggaagctttcatcagaattcagagggtatagattctggaattgctaga
agtcagatggttgcttctcattgggttcttcggctcaaaaagaaagatgccaaaatggca
aaggatatgttgaaaaaactcggatggttagatctcgggagaaaagcccattcgcaggaa
gatggaaaagatatttgtttccccgttacagaaaattttcgtgcgttattcaaccagaga
aacaatctggagggtgtttccgaatctgtttgtcaatcagagaaagatacctgcatgata
gccttgaacattttgattgaatgtggagcaactatactagctgatgaaatcgtcaaagtt
aaaaaggcttcacattctccattcaaagtgatgaaggaagctgtaggctctttgctaagt
gaccgaggcctgccattgcaacttctagaggagttaccttcaagatgggaacgacttggt
gatattgtcgtgcttcctttaacatccttcaaggattcagcatgggacttgattggacaa
gagctttggtttatcgtcgcaaaatccctgggggctattcgccttgctcgacaagggcga
gttgcaccaactggtacacgggacagtaccttagagatacttgttggagataatggttgg
gtcaaccaccgagaaaatggaattctttattcttttgatgctactaagtgcatgttttca
tggggtaatctctctgagaagcttcggatgggccactttgattgcaaagacgaagttata
gtagatttatttgctggcattggatattttgtgctgcccttcctagtgagggccaaagcc
aggcttgtgtatgcttgtgaatggaatccgcatgcagttgaggcacttcgtcataatctt
gaagctaatcttgttgctgaccgctgtgtattactcgaaggagataatcgaattacagcg
ccaaaaggtgtagctgatagagtgtgtctcggtctcattcctacaagcgagggtagttgg
ctgaccgctgtcagagcattaagagacgagggaggtatattgcacatccatggcaatgtc
aaagattccgaagaacatatctggacaaaccatgtttcccagtcaatccaagaaattgct
agatctgaaggtcatgactgggacgtaacagtagaacatgtcgagagagtgaaatggtac
gcgcctcatattcgccatcttgttgctgatgtgagatgcaaaatgattcagacataa

DBGET integrated database retrieval system